DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and AT5G61050

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_200913.1 Gene:AT5G61050 / 836226 AraportID:AT5G61050 Length:252 Species:Arabidopsis thaliana


Alignment Length:163 Identity:32/163 - (19%)
Similarity:51/163 - (31%) Gaps:55/163 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1052 NFFPGTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYIAAFRTVVMPIARSFNPDIVLVSSGF 1116
            :.|.|.||               ::::..|. .|.|..::..:|..:    ..|| |::...:..
plant   104 SMFWGVGG---------------VAYTNPLT-NLNDQTHMCLYRITL----EQFN-DLLFQENEL 147

  Fly  1117 DAATGHPAPLGGYHVSPACFGFMTRELLQLANGKVVLALEGGYDLAAICDSAQECVRALLGDPAA 1181
            :..:.:|              |.....|:||.      .||...|....||....|..|..:...
plant   148 NVDSDYP--------------FFDLAALRLAE------KEGSISLQTASDSLYGNVVCLGKEGVI 192

  Fly  1182 PI-------------AKAELE-RPPCQNAINTL 1200
            ||             ...|:. |||.:...|||
plant   193 PILTLTCTLSVVEKFKSGEIPIRPPAKAYANTL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 32/163 (20%)
AT5G61050NP_200913.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484694at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.