DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and HDA7

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_198410.1 Gene:HDA7 / 833525 AraportID:AT5G35600 Length:409 Species:Arabidopsis thaliana


Alignment Length:332 Identity:70/332 - (21%)
Similarity:135/332 - (40%) Gaps:63/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   939 DLDTTWNE---HHTATAARMAAGCVIDLA--LKTAKGDLRNGFAVVRPPG--HHAEANLAMGFCF 996
            ::|..|:.   |:.....|..||..|..|  |...:.|:...:|     |  ||.:.:.|.||.:
plant   100 NVDVDWDGPVFHNLFDYCRAYAGGSISAAAKLNRQEADIAINWA-----GGMHHVKKDKASGFGY 159

  Fly   997 FNSIAIAAKLLRQRMPEVRRILIVDWDVHHGNGTQQAFYQSPDILYLSIHRHDDGNFFPGTGGPT 1061
            .|.:.:|   :.:.:...:|:|.::....||:..::||..:..::.:|.|:..|      ||..:
plant   160 VNDVVLA---ILELLKSFKRVLYIEIGFPHGDEVEEAFKDTDRVMTVSFHKVGD------TGDIS 215

  Fly  1062 ECGSGAGLGFNVNISWSGALNPPLGDAEYIAAFRTVVMPIARS----FNPDIVLVSSGFDAATGH 1122
            :.|.|.|..:        :||.||.|.....:.|.:.:|:...    :.|:::::..|.|:..|.
plant   216 DYGEGKGQYY--------SLNAPLKDGLDDFSLRGLFIPVIHRAMEIYEPEVIVLQCGADSLAGD 272

  Fly  1123 PAPLGGYHVSPACFGFMTRELLQLA---NGKVVLALEGGYDL--AAICDSAQECVRA-------L 1175
              |.|.:::|....|    :.||..   |..:::...|||.|  .|.|...:..:..       |
plant   273 --PFGTFNLSIKGHG----DCLQYVRSFNVPLMILGGGGYTLPNVARCWCYETAIAVGEQLDNDL 331

  Fly  1176 LGDPAAPIAKAELE---RPPCQNAINTLQKTIAIQQT---------HWPCVRMLEHTVGLSALET 1228
            .|:......:.:.:   .|..:..:||....|.:::|         |.|.|...:......|.|.
plant   332 PGNDYMKYFRPDYKLHILPTNRQNLNTRLDIITMRETLLAQLSLVMHAPSVPFQDTPSSSQATEA 396

  Fly  1229 LKVEHDE 1235
            .:|:.::
plant   397 AEVDMEK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 64/306 (21%)
HDA7NP_198410.1 HDAC_classI 15..322 CDD:212517 57/249 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.