DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and HDA14

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_567921.1 Gene:HDA14 / 829484 AraportID:AT4G33470 Length:423 Species:Arabidopsis thaliana


Alignment Length:386 Identity:123/386 - (31%)
Similarity:196/386 - (50%) Gaps:45/386 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   841 LAYDPLMLKHSCICGDNAQ-HPEHSGRLQSVWARLNETDLVKR------CDRLRARKATQEELQT 898
            ||...|:...|...|.|.: |||.|.|:.::...|...:|..:      .:....:.||.|::..
plant    60 LADARLIYSVSAALGHNKESHPECSARVPAIVNALEMNELTPKFRGSQILELANFKTATVEDIAN 124

  Fly   899 VHTEAHAMLFGSNQCQLSRPKLENTLSASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDL 963
            ||.:|:  :||..:.      ::....:..:.:...|......||:.:...|..|.||   ::|.
plant   125 VHDKAY--VFGLEKA------MDEASDSGLIFIEGSGPTYATSTTFQDSLIAAGAGMA---LVDS 178

  Fly   964 ALKTAKG--DLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRILIVDWDVHH 1026
            .:..::.  |...|||::|||||||.....||||.|.::||||: ..||...::||.|:|:||||
plant   179 VIAASRNSVDPPIGFALIRPPGHHAVPKGPMGFCVFGNVAIAAR-HAQRTHGLKRIFIIDFDVHH 242

  Fly  1027 GNGTQQAFYQSPDILYLSIHRHDDGNFFPGTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYI 1091
            ||||..||.:.|||.:||.|:  ||: :||||..::.|.|.|.|..:|:...|.    .||....
plant   243 GNGTNDAFTEDPDIFFLSTHQ--DGS-YPGTGKISDIGKGKGEGTTLNLPLPGG----SGDIAMR 300

  Fly  1092 AAFRTVVMPIARSFNPDIVLVSSGFDAATGHPA-PLGGYHVSPACFGFMTRELLQLA----NGKV 1151
            ..|..:::|.|:.|.|||:|||:|:||   |.. ||.....:.|.:..:.:::.:||    .|:.
plant   301 TVFEEIIVPCAQRFKPDIILVSAGYDA---HVLDPLANLQFTTATYYSLAKDIKRLAKEVCGGRC 362

  Fly  1152 VLALEGGYDLAAICDSAQECVRALLGDPAAPIAKAELERP------PCQNAINTLQKTIAI 1206
            |..|||||:|.::..|..:..|||||:.:   ..:|.:.|      |.:...:.:|:..:|
plant   363 VFFLEGGYNLESLSSSVADSFRALLGEDS---LASEFDNPAYLYDEPMRKVRDAIQRAKSI 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 123/386 (32%)
HDA14NP_567921.1 HDAC_classII 80..387 CDD:212518 109/328 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484694at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100220
Panther 1 1.100 - - O PTHR48252
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.