DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and HDA9

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_190054.2 Gene:HDA9 / 823594 AraportID:AT3G44680 Length:426 Species:Arabidopsis thaliana


Alignment Length:404 Identity:97/404 - (24%)
Similarity:164/404 - (40%) Gaps:82/404 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   894 EELQTVHTEAHAMLFGSNQCQLSR----PKLENTLSASFVRLSCGGLGVDLDTTWNEHHTATAAR 954
            |.||.::.| :..||.:...:.:.    |..|:..  .|.:|..||             |..|||
plant    70 EFLQRINPE-NQNLFPNEMARYNLGEDCPVFEDLF--EFCQLYAGG-------------TIDAAR 118

  Fly   955 MAAGCVIDLALKTAKGDLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRILI 1019
            .....:.|:|:..|.|            .|||:...|.|||:.|.:.:....|.:..|   |:|.
plant   119 RLNNKLCDIAINWAGG------------LHHAKKCDASGFCYINDLVLGILELLKHHP---RVLY 168

  Fly  1020 VDWDVHHGNGTQQAFYQSPDILYLSIHRHDDGNFFPGTGGPTECGSGAGLGFNVNISWSGALNPP 1084
            :|.|||||:|.::|||.:..::.:|.|:..| .||||||...|.|...|..:.:|:    .|...
plant   169 IDIDVHHGDGVEEAFYFTDRVMTVSFHKFGD-KFFPGTGDVKEIGEREGKFYAINV----PLKDG 228

  Fly  1085 LGDAEYIAAFRTVVMPIARSFNPDIVLVSSGFDAATGHPAPLGGYHVS----PACFGFMTRELLQ 1145
            :.|:.:...|||::..:...:.|..:::..|.|:....  .||.:::|    ..|..|:.:..|.
plant   229 IDDSSFNRLFRTIISKVVEIYQPGAIVLQCGADSLARD--RLGCFNLSIDGHAECVKFVKKFNLP 291

  Fly  1146 LANGKVVLALEGGY--DLAAICDSAQ----------------ECVRALLGDPAAPIAKAELERPP 1192
            |     ::...|||  :..|.|.:.:                :.::....|.:..|....:|...
plant   292 L-----LVTGGGGYTKENVARCWTVETGILLDTELPNEIPENDYIKYFAPDFSLKIPGGHIENLN 351

  Fly  1193 CQNAINTLQKTIA-----IQQTHWPCVRMLEHTVGLSALETLKVEHDESETINAMAGLSMQSMHR 1252
            .::.|::::..|.     ||  |.|.|:|.|     ...:....:.||.|. |.......:|..:
plant   352 TKSYISSIKVQILENLRYIQ--HAPSVQMQE-----VPPDFYIPDFDEDEQ-NPDVRADQRSRDK 408

  Fly  1253 TLSRDDSEEPMDQD 1266
            .:.|||.....|.|
plant   409 QIQRDDEYFDGDND 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 82/347 (24%)
HDA9NP_190054.2 PTZ00063 6..396 CDD:240251 90/376 (24%)
Arginase_HDAC 6..384 CDD:302587 87/363 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.