DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and hda17

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_190035.1 Gene:hda17 / 823574 AraportID:AT3G44490 Length:158 Species:Arabidopsis thaliana


Alignment Length:175 Identity:43/175 - (24%)
Similarity:67/175 - (38%) Gaps:46/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   903 AHAMLF-GSNQCQLSRPKLENTLSASFVR------LSCGGLGVDLDTTWNEHHTATAARMAAGCV 960
            |.:||| |..:|            ..||:      |..||.|      :.:.:.|....:..|.:
plant     2 AFSMLFTGHAEC------------VKFVKKFNLPLLVTGGGG------YTKENVARCWTVETGIL 48

  Fly   961 IDLAL--KTAKGDLRNGFA---VVRPPGHHAEANLAMGFCFFNSIAI-AAKLLR--QRMPEVRR- 1016
            :|..|  :.::.|....||   .::.||.|.| ||... .:.:||.: ..:.||  |..|.|:. 
plant    49 LDTELPNEISENDYIKYFAPDFSLKIPGGHIE-NLNTK-SYISSIKVQILENLRYIQHAPSVQMQ 111

  Fly  1017 -----ILIVDWDVHHGNGTQQAFYQSPDILYLSIHRHDDGNFFPG 1056
                 ..|.|:|....|...:...:|.|   ..|.|.|:  :|.|
plant   112 EVPPDFYIPDFDEDEQNPDVRVDQRSRD---KQIQRDDE--YFDG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 43/175 (25%)
hda17NP_190035.1 Arginase_HDAC <3..116 CDD:302587 31/132 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.