DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and Hdac8

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_006528338.1 Gene:Hdac8 / 70315 MGIID:1917565 Length:386 Species:Mus musculus


Alignment Length:360 Identity:97/360 - (26%)
Similarity:163/360 - (45%) Gaps:53/360 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 QPSASGSPPHKVTTGLAYDPLMLKHSCICGDNAQHPEHSGRLQSVWARLNETDLVKRCDRLRARK 890
            :|:.||   |.:.....|.|   ::..||....:.|:.:..:.|:   :....|.|:...::.:.
Mouse     6 EPANSG---HSLPPVYIYSP---EYVSICDSLVKVPKRASMVHSL---IEAYALHKQMRIVKPKV 61

  Fly   891 ATQEELQTVHTEAHAMLFGSNQCQLSRPKLE----NTLSASFVRLSCGGLGVDLDTTWNEHHTAT 951
            |:.||:.|.||:|:..       .|.:...|    :..|..:      |||.|...|......|.
Mouse    62 ASMEEMATFHTDAYLQ-------HLQKVSQEGDEDHPDSIEY------GLGYDCPATEGIFDYAA 113

  Fly   952 A----ARMAAGCVIDLALKTAKGDLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMP 1012
            |    ...||.|:||...|.|. :...|:       |||:.:.|.|||:.|...:....||::..
Mouse   114 AIGGGTITAAQCLIDGKCKVAI-NWSGGW-------HHAKKDEASGFCYLNDAVLGILRLRRKFD 170

  Fly  1013 EVRRILIVDWDVHHGNGTQQAFYQSPDILYLSIHRHDDGNFFPGTGGPTECGSGAGLGFNVNISW 1077
               |||.||.|:|||:|.:.||..:..::.:|:|:...| ||||||..::.|.|.|..::||:  
Mouse   171 ---RILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPG-FFPGTGDMSDVGLGKGRYYSVNV-- 229

  Fly  1078 SGALNPPLGDAEYIAAFRTVVMPIARSFNPDIVLVSSGFDAATGHPAPLGGYHVSPACFGFMTRE 1142
              .:...:.|.:|.....:|:..:.::|||..|::..|.|...|.  |:..::::|...|...:.
Mouse   230 --PIQDGIQDEKYYHICESVLKEVYQAFNPKAVVLQLGADTIAGD--PMCSFNMTPVGIGKCLKY 290

  Fly  1143 LLQLANGKVVLALEGGYDLAAICDSAQECVRALLG 1177
            :||.....::|. .|||:||    :...|...|.|
Mouse   291 VLQWQLATLILG-GGGYNLA----NTARCWTYLTG 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 93/349 (27%)
Hdac8XP_006528338.1 HDAC8 16..370 CDD:212524 93/347 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.