powered by:
Protein Alignment HDAC4 and AT4G09784
DIOPT Version :9
Sequence 1: | NP_001259507.1 |
Gene: | HDAC4 / 32278 |
FlyBaseID: | FBgn0041210 |
Length: | 1269 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001154218.1 |
Gene: | AT4G09784 / 6240301 |
AraportID: | AT4G09784 |
Length: | 70 |
Species: | Arabidopsis thaliana |
Alignment Length: | 39 |
Identity: | 14/39 - (35%) |
Similarity: | 23/39 - (58%) |
Gaps: | 1/39 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 860 HPEHSGRLQSVWARLNETDLVK-RCDRLRARKATQEELQ 897
|||...||:::.|.|:...:.. ||..:.|.:.|::|||
plant 12 HPERPDRLRAIAASLDTAGVFPGRCLPINAGEITKQELQ 50
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0123 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.