DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and phka1a

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_005166576.1 Gene:phka1a / 572183 ZFINID:ZDB-GENE-031118-56 Length:1232 Species:Danio rerio


Alignment Length:95 Identity:25/95 - (26%)
Similarity:39/95 - (41%) Gaps:6/95 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SPDDRIPIHDLPSEAGSDERLLHITPATLTLDFKPHPAVDIDQQIMELKKSQELQKQRLINSFQE 67
            ||...:.:.|.|. .|:|.....:.|:...|....|.|:|....:..||.:|.|..|..|.....
Zfish   722 SPQPALNLKDFPG-LGTDHSSEVVVPSENNLPRDTHGAIDYSSLVQVLKDTQSLHDQADILYILF 785

  Fly    68 QSKQMELEHKLQLEHKYQKQPTNKRFSLEL 97
            :.|.|:.:.:|     :.|..|.|...:||
Zfish   786 KDKGMDWDTQL-----HGKGTTVKSLLVEL 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922 9/43 (21%)
HDAC_classIIa 837..1211 CDD:212544
phka1aXP_005166576.1 Glyco_hydro_15 8..>439 CDD:279112
Glyco_hydro_15 <802..919 CDD:279112 4/9 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.