DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and Sirt7

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_651664.2 Gene:Sirt7 / 43433 FlyBaseID:FBgn0039631 Length:771 Species:Drosophila melanogaster


Alignment Length:389 Identity:74/389 - (19%)
Similarity:128/389 - (32%) Gaps:85/389 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 LGHPMLTGAVQLNVVQTHYENSEAERQAYEHQVVNQKVRQTVLTRSGAAAAAAAAAGVSVVREAQ 659
            :|...|:.|   |...||....|..|:...|.||:|......| |||             :....
  Fly   159 IGEHDLSSA---NPTYTHMALYELHRRRLLHHVVSQNCDGLHL-RSG-------------LPRNS 206

  Fly   660 LKEEDDDSAAEVMDLTDKKKPPKTVL----------------TSTIATSTSQNLPEALAAAAAAA 708
            |.|...:...||.    |...|.:|.                |..:....|:.|.:.:.......
  Fly   207 LSEIHGNMYVEVC----KNCRPNSVYWRQFDTTEMTARYCHKTHRLCHRCSEPLYDTIVHFGERG 267

  Fly   709 AYRAPHNASSNSASATKSGIKLRDQEYLQQQREQLLLLQQE---EELAKSLMRPLSRTLSSPLVP 770
            ..:.|.|.:..:|:|.::.:.|.....|:..::...|.|.:   .:.||..:..|..|....:..
  Fly   268 NVKWPLNWAGATANAQRADVILCLGSSLKVLKKYTWLWQMDRPARQRAKICVVNLQWTPKDAIAS 332

  Fly   771 LGPHG-----LSQIPDTGQQPAPIATSSSADHIPPVNLSLPHRQHRQLMSTLYASQLRNHQPSAS 830
            :..:|     ::|:......|.|:.|..........:|.:|...|     ||....|:|    |.
  Fly   333 IKINGKCDQVMAQLMHLLHIPVPVYTKEKDPIFAHASLLMPEELH-----TLTQPLLKN----AD 388

  Fly   831 GSPPHKVTTGLAYDPLMLKHSCIC---------GDNAQHPEHSGRLQSVWARLNETDLVKRCDRL 886
            .......||....|..:...||..         |...:.|..:||      |: :|:|..| .:.
  Fly   389 EEEAFTTTTEETQDSTISSESCSFNYSDLPIGKGPRIRTPIKNGR------RV-KTNLELR-QKF 445

  Fly   887 RARKATQEELQTVHTEAHAMLFGSNQCQLSRPKLENTL----SASFVRLSCGGLGVDLDTTWNE 946
            :......||::..|.:.:    |..:.:.....||:::    .....:|.|.      ||.:.:
  Fly   446 KTLNGQDEEIKVEHVKTN----GEVKTEKDLITLESSIKIETEVKLEKLECS------DTNFQQ 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 23/123 (19%)
Sirt7NP_651664.2 SIRT7 124..338 CDD:238701 38/199 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.