DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and Hdac1

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_032254.1 Gene:Hdac1 / 433759 MGIID:108086 Length:482 Species:Mus musculus


Alignment Length:455 Identity:111/455 - (24%)
Similarity:185/455 - (40%) Gaps:104/455 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   860 HPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTVHTEAHAMLFGS----NQCQLSR--- 917
            ||....|::.....|....|.::.:..|..||..||:...|::.:.....|    |..:.|:   
Mouse    28 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQ 92

  Fly   918 --------PKLENTLSASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDLALKTAKGDLRN 974
                    |..:...  .|.:||.|| .|......|:..|..|...|.|.               
Mouse    93 RFNVGEDCPVFDGLF--EFCQLSTGG-SVASAVKLNKQQTDIAVNWAGGL--------------- 139

  Fly   975 GFAVVRPPGHHAEANLAMGFCFFNSIAIA-AKLLRQRMPEVRRILIVDWDVHHGNGTQQAFYQSP 1038
                     |||:.:.|.|||:.|.|.:| .:||:..    :|:|.:|.|:|||:|.::|||.:.
Mouse   140 ---------HHAKKSEASGFCYVNDIVLAILELLKYH----QRVLYIDIDIHHGDGVEEAFYTTD 191

  Fly  1039 DILYLSIHRHDDGNFFPGTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYIAAFRTVVMPIAR 1103
            .::.:|.|::  |.:|||||...:.|:|.|..:.||.    .|...:.|..|.|.|:.|:..:..
Mouse   192 RVMTVSFHKY--GEYFPGTGDLRDIGAGKGKYYAVNY----PLRDGIDDESYEAIFKPVMSKVME 250

  Fly  1104 SFNPDIVLVSSGFDAATGHPAPLGGYHVSPACFGFMTR------ELLQLANGKVVLALEGGYDL- 1161
            .|.|..|::..|.|:.:|.  .||       ||....:      |.::..|..:::...|||.: 
Mouse   251 MFQPSAVVLQCGSDSLSGD--RLG-------CFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIR 306

  Fly  1162 -AAICDSAQECVRALLGDPAAP-------------------IAKAELERPPCQNAINTLQKTIAI 1206
             .|.|.:.:..| ||  |...|                   |:.:.:..   ||....|:|   |
Mouse   307 NVARCWTYETAV-AL--DTEIPNELPYNDYFEYFGPDFKLHISPSNMTN---QNTNEYLEK---I 362

  Fly  1207 QQTHWPCVRMLEHTVG--LSAL--ETLKVEHDESETINAMAGLSMQSMHRTLSRDDSEEPMDQDE 1267
            :|..:..:|||.|..|  :.|:  :.:..|..:.:..:....:|:.|..:.::.:  ||..|.||
Mouse   363 KQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACE--EEFSDSDE 425

  Fly  1268  1267
            Mouse   426  425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 97/393 (25%)
Hdac1NP_032254.1 HDAC1 4..374 CDD:212534 99/400 (25%)
Histone deacetylase 9..321 88/341 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 390..482 8/38 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.