DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and Sirt2

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001287422.2 Gene:Sirt2 / 42414 FlyBaseID:FBgn0038788 Length:386 Species:Drosophila melanogaster


Alignment Length:83 Identity:26/83 - (31%)
Similarity:38/83 - (45%) Gaps:14/83 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSDERLLHITPATLTLDF-KPHPAVDI------DQQIMELKKS----QELQKQRLINSFQEQ-SK 70
            |....:|.:.|.|.:|.| ||:...|:      |..:|.|.|:    |||  |:||.|.::: |.
  Fly   291 GQASCVLFMDPNTRSLLFDKPNNTRDVAFLGDCDAGVMALAKALGWDQEL--QQLITSERKKLSG 353

  Fly    71 QMELEHKLQLEHKYQKQP 88
            ....|...|.:.|.|..|
  Fly   354 SQNSEELQQGKEKPQSDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922 16/54 (30%)
HDAC_classIIa 837..1211 CDD:212544
Sirt2NP_001287422.2 SIRT1 79..330 CDD:238699 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.