DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and Sirt6

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_649990.2 Gene:Sirt6 / 41254 FlyBaseID:FBgn0037802 Length:325 Species:Drosophila melanogaster


Alignment Length:371 Identity:66/371 - (17%)
Similarity:119/371 - (32%) Gaps:110/371 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   694 SQNLPEALAAAAAAAAYRAPHNASSNSASATKSGIKLRDQEYLQQQREQLLLLQQEEELAKSLMR 758
            |.|..:.|:|........||.:..|:...|.|                    .|:..||.|....
  Fly     2 SCNYADGLSAYDNKGILGAPESFDSDEVVAEK--------------------CQELAELIKKSGH 46

  Fly   759 PLSRT----LSSPLVP--LGPHGLSQIPDTGQQPAPIATSSSADHIPPVNLSL----PHRQHRQL 813
            .:..|    .:|..:|  .||.|:..:.:.|::             |..|:|.    |.:.|..:
  Fly    47 VVLHTGAGISTSAGIPDFRGPKGVWTLEEKGEK-------------PDFNVSFDEARPTKTHMAI 98

  Fly   814 MSTLYASQLRNHQPSASGSPPHKVTTGLAYDPLMLKHSCICGDNAQHPEHSGRLQSVWARLNETD 878
            ::.:           .||...:.::..:  |.|.||              ||..:...:.|:...
  Fly    99 IALI-----------ESGYVQYVISQNI--DGLHLK--------------SGLDRKYLSELHGNI 136

  Fly   879 LVKRCDRLRARKATQEELQTVHTEAHAMLFGSNQCQLSRPKLENTLSASFVRLSC-GGLGVDLDT 942
            .:::|.:.|.:..:...::||..::......|:.....|              || .|:..|...
  Fly   137 YIEQCKKCRRQFVSPSAVETVGQKSLQRACKSSMDSKGR--------------SCRSGILYDNVL 187

  Fly   943 TWNE------------HHTATAARMAAGCVI------DLALKTAKGDLRNGFAVVRPPGHHAEAN 989
            .|..            |.|.....:|.|..:      ||.||..|...:.....::|..|..:||
  Fly   188 DWEHDLPENDLEMGVMHSTVADLNIALGTTLQIVPSGDLPLKNLKCGGKFVICNLQPTKHDKKAN 252

  Fly   990 LAMGFCFFNSIAIAAKLLRQRMPE-------VRRILIVDWDVHHGN 1028
            |.:.......::...|||...:||       .::...::|.:...|
  Fly   253 LIISSYVDVVLSKVCKLLGVEIPEYSEASDPTKQSKPMEWTIPTSN 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 39/218 (18%)
Sirt6NP_649990.2 SIRT7 45..258 CDD:238701 46/266 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48252
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.