DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and Hdac10

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_006242280.1 Gene:Hdac10 / 362981 RGDID:1305874 Length:666 Species:Rattus norvegicus


Alignment Length:401 Identity:146/401 - (36%)
Similarity:208/401 - (51%) Gaps:33/401 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   839 TGLAYDPLMLKHSCICGDNAQHPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTVHTEA 903
            |.|.|...|.....:..|.....|...||.:....|.:..|.:||..|...:|::|||..||:..
  Rat     3 TALVYHEDMTATRLLWDDPECEIECPERLTAALDGLRQRGLEERCQCLSVCEASEEELGLVHSPE 67

  Fly   904 HAMLFGSNQCQLSRPKLENTLSASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDLALKTA 968
            :..|....| .|.:.:| :|||..:            |..:....|...||:|||..:.|.....
  Rat    68 YIALVQKTQ-TLDKEEL-HTLSKQY------------DAVYFHPDTFHCARLAAGAALRLVDAVL 118

  Fly   969 KGDLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRILIVDWDVHHGNGTQQA 1033
            .|.:.||.|:|||||||::...|.|||.||::||||:..:|:. .::||||||||||||.|.|..
  Rat   119 TGAVHNGVALVRPPGHHSQRAAANGFCVFNNVAIAARHAKQKY-GLQRILIVDWDVHHGQGIQYI 182

  Fly  1034 FYQSPDILYLSIHRHDDGNFFP--GTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYIAAFRT 1096
            |...|.:||.|.||::.|||:|  ........|.|.|.||.||:.|:   ...:|:|:|:|||..
  Rat   183 FEDDPSVLYFSWHRYEHGNFWPFLPESDADTVGRGRGQGFTVNLPWN---QVGMGNADYLAAFLH 244

  Fly  1097 VVMPIARSFNPDIVLVSSGFDAATGHPAPLGGYHVSPACFGFMTRELLQLANGKVVLALEGGYDL 1161
            |::|:|..|:|::||||:|||:|.|.|.  |....:|.||..:|:.|..||.|::...|||||.|
  Rat   245 VLLPLAFEFDPELVLVSAGFDSAIGDPE--GQMQATPECFAHLTQLLQVLAGGRICAVLEGGYHL 307

  Fly  1162 AAICDSAQECVRALLGDPAAPIAKAELERPPCQNAINTLQKTIAIQQTHW--------PCVRMLE 1218
            .::..|....|:.|||||..|:....:   |||:|:.::|.....|..||        |.:....
  Rat   308 ESLAQSVCMMVQTLLGDPTPPLPGLMV---PCQSALESIQSVRTAQTPHWTSLQQNVAPVLSSST 369

  Fly  1219 HTVGLSALETL 1229
            |:...|:|..|
  Rat   370 HSPEGSSLPVL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 139/373 (37%)
Hdac10XP_006242280.1 Arginase_HDAC 18..354 CDD:302587 135/358 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484694at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.