DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and hda-11

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_505699.3 Gene:hda-11 / 183226 WormBaseID:WBGene00007953 Length:334 Species:Caenorhabditis elegans


Alignment Length:373 Identity:81/373 - (21%)
Similarity:128/373 - (34%) Gaps:110/373 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   860 HPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTVHTEAHAMLFGSNQCQLSRP-KLENT 923
            ||..|.:.:.|...|.|.:|:.....:.....|.|||..||...:..       .:..| |....
 Worm    36 HPFDSSKWRRVITHLKEMNLITDETLVEPNLPTFEELTRVHDRKYLK-------SVRNPIKAAQI 93

  Fly   924 LSASFV----------------RLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDLALKTAKGDL 972
            :...||                ||..||             |..||.:|               |
 Worm    94 VEIPFVGCLPPCIIESKLLHPLRLQAGG-------------TVLAANLA---------------L 130

  Fly   973 RNGFAVVRPPG-HHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRILIVDWDVHHGNGTQQAFYQ 1036
            ::|:|:....| |||..:...||||:..|.:|...|..: ..:...::||.|.|.|||..:.|..
 Worm   131 KHGWAINVGGGFHHASHSGGGGFCFYADITMAIFDLFDK-KAIANAIVVDLDAHQGNGHARDFAD 194

  Fly  1037 SPDIL-------YLSIHRHDDGNFFPGTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYIAAF 1094
            :|::.       |:..|..:...|                     |:.:..:|....|..|::..
 Worm   195 NPNVFVFDVFNPYVYPHDREARQF---------------------INRAVHVNGHTTDTSYLSEL 238

  Fly  1095 R----TVVMPIARSFNP--DIVLVSSGFDAATGHPAPLGGYHVSPACFGFMTRELLQLANGK--- 1150
            |    ..::...::..|  |.::.::|.|...|.  |||...:||.|.......:..||..|   
 Worm   239 RKQLAQCLIDREKTTPPGFDFIMFNAGTDCLLGD--PLGAMKLSPQCIIARDEVVFNLAKSKGIP 301

  Fly  1151 VVLALEGGYDLAAICDSAQECVRALLGDPAAPIAKAELERPPCQNAIN 1198
            :.:...|||.                .|.|..|||: :|....:|.|:
 Worm   302 ICMVTSGGYQ----------------KDNALLIAKS-IENLQSKNLIS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 81/373 (22%)
hda-11NP_505699.3 HDAC_classIV 36..325 CDD:212519 79/364 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.