DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and F43G6.4

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_496519.2 Gene:F43G6.4 / 174810 WormBaseID:WBGene00009657 Length:270 Species:Caenorhabditis elegans


Alignment Length:268 Identity:55/268 - (20%)
Similarity:86/268 - (32%) Gaps:89/268 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 HQQQQ-----QQQQHQQQQQQQQARGRDGMKLKQNCSANASPEVKQIL-------NCFILSRKSQ 195
            |.|||     .|...|||.||:.:.|...:...|..|.:.||:.|:::       .|.:.:.|..
 Worm    36 HMQQQYFLNIMQLVQQQQYQQRLSSGGSPVNSDQASSRSESPQTKKLILDEDGCATCSVCTEKVP 100

  Fly   196 AAASNG------------TTTTSPYRNRGVVKSSSGESLPAGTVTSAHPYKIPQPPPSLLKYESD 248
            .|..|.            .|.|...|.|      ..|:.|                        |
 Worm   101 EAEWNSHIELEKERLISYITLTKEKRER------DRENTP------------------------D 135

  Fly   249 FPLRKTASEPNLLKIRLKQSVIERKARIGGPAGARRHERLLQAAQRRQQKNSVLTNCNSTPDSGP 313
            ...:|...|..|.:||..|:  :|::...||...|   ..|....|:....   |..:.:||...
 Worm   136 HFDQKRKRELELQRIRNNQN--KRQSLKRGPQLVR---DCLTPFSRQSNDE---TGSSESPDMKK 192

  Fly   314 NS----------PPSAAALAV-----------------GVVGSRGSPTSAPIQEENEEGSQYQPG 351
            :.          .|.:.|:.:                 .|:.|..||||:..:|:.:..|.....
 Worm   193 DDEFYMKCTTCHQPCSYAIVMSAFDRPKCQICFDLVRAAVLNSAASPTSSATKEDPDHDSSPPAC 257

  Fly   352 QRSSINDL 359
            ::..|.||
 Worm   258 KKMKIEDL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544
F43G6.4NP_496519.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.