DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and Hdac10

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_006520600.1 Gene:Hdac10 / 170787 MGIID:2158340 Length:667 Species:Mus musculus


Alignment Length:375 Identity:138/375 - (36%)
Similarity:200/375 - (53%) Gaps:25/375 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   839 TGLAYDPLMLKHSCICGDNAQHPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTVHTEA 903
            |.|.|...|.....:..|.....|...||.:....|.:..|.:||..|.|.:|::|||..||:..
Mouse     3 TALVYHEDMTATRLLWDDPECEIECPERLTAALDGLRQRGLEERCLCLSACEASEEELGLVHSPE 67

  Fly   904 HAMLFGSNQCQLSRPKLENTLSASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDLALKTA 968
            :..|....| .|.:.:| :.||..:            :..:....|...||:|||..:.|.....
Mouse    68 YIALVQKTQ-TLDKEEL-HALSKQY------------NAVYFHPDTFHCARLAAGAALQLVDAVL 118

  Fly   969 KGDLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRILIVDWDVHHGNGTQQA 1033
            .|.:.||.|:|||||||::...|.|||.||::|:|||..:|:. .::||||||||||||.|.|..
Mouse   119 TGAVHNGLALVRPPGHHSQRAAANGFCVFNNVALAAKHAKQKY-GLQRILIVDWDVHHGQGIQYI 182

  Fly  1034 FYQSPDILYLSIHRHDDGNFFP--GTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYIAAFRT 1096
            |...|.:||.|.||::.|:|:|  ........|.|.|.||.||:.|:   ...:|:|:|:|||..
Mouse   183 FNDDPSVLYFSWHRYEHGSFWPFLPESDADAVGQGQGQGFTVNLPWN---QVGMGNADYLAAFLH 244

  Fly  1097 VVMPIARSFNPDIVLVSSGFDAATGHPAPLGGYHVSPACFGFMTRELLQLANGKVVLALEGGYDL 1161
            |::|:|..|:|::||||:|||:|.|.|.  |....:|.||..:|:.|..||.|::...|||||.|
Mouse   245 VLLPLAFEFDPELVLVSAGFDSAIGDPE--GQMQATPECFAHLTQLLQVLAGGRICAVLEGGYHL 307

  Fly  1162 AAICDSAQECVRALLGDPAAPIAKAELERPPCQNAINTLQKTIAIQQTHW 1211
            .::..|....|:.|||||..|:....:   |||:|:.::|.....|..:|
Mouse   308 ESLAQSVCMMVQTLLGDPTPPLLGLMV---PCQSALESIQSVQTAQTPYW 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 137/373 (37%)
Hdac10XP_006520600.1 Arginase_HDAC 18..354 CDD:388375 133/358 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484694at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2991
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.