DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and AgaP_AGAP006511

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_316539.2 Gene:AgaP_AGAP006511 / 1277106 VectorBaseID:AGAP006511 Length:470 Species:Anopheles gambiae


Alignment Length:440 Identity:104/440 - (23%)
Similarity:177/440 - (40%) Gaps:96/440 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   860 HPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTVHTEAHAMLFGSNQCQLSRPKLENTL 924
            ||....|::.....|....|.::.:..|..|||.:|:...|::.:.....|     .||...:..
Mosquito    26 HPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTKFHSDDYIRFLRS-----IRPDNMSEY 85

  Fly   925 SASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDLALKTAK----------GDLRNGFAVV 979
            :....|.:.|......|..:.      ..:::||..:..|:|..|          |.|       
Mosquito    86 NKHMQRFNVGEDCPVFDGLYE------FCQLSAGGSVAAAVKLNKQASEICINWGGGL------- 137

  Fly   980 RPPGHHAEANLAMGFCFFNSIAIA-AKLLRQRMPEVRRILIVDWDVHHGNGTQQAFYQSPDILYL 1043
                |||:.:.|.|||:.|.|.:. .:||:..    :|:|.:|.|||||:|.::|||.:..::.:
Mosquito   138 ----HHAKKSEASGFCYVNDIVLGILELLKYH----QRVLYIDIDVHHGDGVEEAFYTTDRVMTV 194

  Fly  1044 SIHRHDDGNFFPGTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYIAAFRTVVMPIARSFNPD 1108
            |.|::  |.:|||||...:.|:|.|..:.|||    .|...:.|..|.:.|..::..:..:|.|.
Mosquito   195 SFHKY--GEYFPGTGDLRDIGAGRGKYYAVNI----PLRDGMDDESYDSIFVPIISKVMETFQPS 253

  Fly  1109 IVLVSSGFDAATGHPAPLGGYHVSPACFGFMTR------ELLQLANGKVVLALEGGYDLAAI--C 1165
            .|::..|.|:.||.  .||       ||....:      |.::..|...::...|||.:..:  |
Mosquito   254 AVVLQCGADSLTGD--RLG-------CFNLTVKGHGKCVEFVKKYNLPFLMVGGGGYTIRNVSRC 309

  Fly  1166 DSAQECVRALLGDPAA-------------PIAKAELERPPCQNAINTLQKTIAIQQTHWPCVRML 1217
            .:.:..|  .||...|             |..|..:. |...:..||.:....|:...:..:|||
Mosquito   310 WTYETSV--ALGVEIANELPYNDYFEYFGPDFKLHIS-PSNMSNQNTTEYLEKIKNRLFENLRML 371

  Fly  1218 EHTVGLSALETLKVEHDESETINAMAGLSMQSMHRTLSRDDSEEPMDQDE 1267
            .|..|      ::|:....:.||              ...:.|:.:|:||
Mosquito   372 PHAPG------VQVQPIPEDAIN--------------DESEDEDKVDKDE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 92/382 (24%)
AgaP_AGAP006511XP_316539.2 Arginase_HDAC 5..372 CDD:302587 94/389 (24%)
PTZ00063 6..396 CDD:240251 101/433 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.