DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG and psme2

DIOPT Version :9

Sequence 1:NP_001259502.1 Gene:REG / 32274 FlyBaseID:FBgn0029133 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001011494.1 Gene:psme2 / 496995 XenbaseID:XB-GENE-957036 Length:242 Species:Xenopus tropicalis


Alignment Length:243 Identity:80/243 - (32%)
Similarity:129/243 - (53%) Gaps:13/243 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DTVVKVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFEEVHQDLNIPVLPPLLVKN 68
            |...||..::::|..:.:..:.:..|..|.::::||.:.:||..:...:|.:||||:..|  ...
 Frog    12 DNQEKVNGFREALFSQVQQFLFEFVPLKIQQMDDLLKSDLFNVEDLATLHTELNIPIPDP--PTE 74

  Fly    69 ELEDRDSLPTKRQRVDVIVSGQPVMGLP-AGTVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMWIS 132
            |.||...:.|.::....          | .|.:..|:.|..::..|:|.||:|.|...|:..||.
 Frog    75 ESEDSSKMETDKEEKKA----------PRCGFLKENEKLQNVLNTVQPEIRRLREGCALIITWIH 129

  Fly   133 FMIPKIEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAV 197
            .:||||||||:||||:||..:..:..|:::.......||:||..|..||:|.:|..|:.|||..|
 Frog   130 HLIPKIEDGNDFGVSVQEKLVERVTAVKTKVETTQTNISKYFSERGDVVAKASKETHVMDYRALV 194

  Fly   198 VELDEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSNTESLY 245
            .|.||..::.|.:...||||.|..:.||::||.||:..|:.....|:|
 Frog   195 HEKDEITFVDLKIAFTEVRNFYVEIFDIILKNFEKITNPKGDEKSSMY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REGNP_001259502.1 PA28_alpha 5..60 CDD:280421 13/54 (24%)
PA28_beta 102..243 CDD:280422 56/140 (40%)
psme2NP_001011494.1 PA28_alpha 11..71 CDD:366999 15/58 (26%)
PA28_beta 96..240 CDD:367000 56/143 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251022at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.