DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG and psme1

DIOPT Version :9

Sequence 1:NP_001259502.1 Gene:REG / 32274 FlyBaseID:FBgn0029133 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_571450.1 Gene:psme1 / 30648 ZFINID:ZDB-GENE-991110-17 Length:248 Species:Danio rerio


Alignment Length:235 Identity:83/235 - (35%)
Similarity:136/235 - (57%) Gaps:14/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFEEVHQDLNIPVLPPLLVKNEL-- 70
            :|..:...:..:||.||:|.|||.|..::.:|.... :.::...:...|:||:..|  ||.||  
Zfish    13 QVDGFSQKITKEAEQLISKIFPEKIAEMDNVLQGSC-SLKDLSVIKAPLDIPIPDP--VKEELKR 74

  Fly    71 ---EDRDSLPTKRQRVDVIVSGQPVMGLPAGTVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMWIS 132
               |::::...|:.:.|      ...|.|.|.:.||:.:.::||.:||.|:.|.|..|.:.|||.
Zfish    75 KKKEEKEAKEGKKDKED------EDAGPPCGPIACNETVEKLIKQIKPEIQTLKECLNTVSMWIQ 133

  Fly   133 FMIPKIEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAV 197
            ..:|:|||||||||::||.....:....::...|..|||:|:..|...|:|.:|.||:.|:|:.|
Zfish   134 LQVPRIEDGNNFGVAVQEKVFELMTNTRTKIEGFQTQISKYYSERGDAVAKASKQPHVGDFRQLV 198

  Fly   198 VELDEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPR 237
            .|||:.:|..|.::|.|:||.|:.|:|::.||.:|:||||
Zfish   199 HELDQHQYCELRIIVLEIRNTYAMLYDVITKNFDKIKKPR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REGNP_001259502.1 PA28_alpha 5..60 CDD:280421 13/51 (25%)
PA28_beta 102..243 CDD:280422 58/136 (43%)
psme1NP_571450.1 PA28_alpha 10..66 CDD:280421 14/53 (26%)
PA28_beta 103..240 CDD:280422 58/136 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593977
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251022at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10660
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.