DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG and psme2

DIOPT Version :9

Sequence 1:NP_001259502.1 Gene:REG / 32274 FlyBaseID:FBgn0029133 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_571449.1 Gene:psme2 / 30647 ZFINID:ZDB-GENE-991110-16 Length:244 Species:Danio rerio


Alignment Length:245 Identity:83/245 - (33%)
Similarity:133/245 - (54%) Gaps:13/245 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NDTVVKVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFEEVHQDLNIPVL-PPLLV 66
            :|..|:::.|:.||..:||.|.:...|..|..|:.||....|:..:...:|..|:||:. ||...
Zfish    11 SDNAVRIENYRQSLYKQAEDLFSNYIPLKISHLDNLLKGDEFSITDLSSLHAPLDIPIPDPPAPE 75

  Fly    67 KNELE-DRDSLPTKRQRVDVIVSGQPVMGLPAGTVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMW 130
            ..|:| |::....|:::.       |..|...|    |:.:.:::.:|||.|..|.|....:..|
Zfish    76 DEEMETDKNEDDEKKKKA-------PKCGFIKG----NERIVKLLDIVKPEIMGLKETCITVSCW 129

  Fly   131 ISFMIPKIEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRR 195
            |:.:||||||||:|||:|||..|..|..|:::...|...|::||..|...|:|.:|..|:.|||.
Zfish   130 IAHLIPKIEDGNDFGVAIQEKILERITAVKTKVEGFQTNINKYFSERGDAVAKASKDTHVMDYRS 194

  Fly   196 AVVELDEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSNTESLY 245
            .|.|.||..|..:.::|.::|..|:.|:|::.|||||:..|:.....|:|
Zfish   195 LVHEKDEAAYSEIRVIVLDIRGFYAELYDVISKNLEKVTNPKGEEKPSMY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REGNP_001259502.1 PA28_alpha 5..60 CDD:280421 16/54 (30%)
PA28_beta 102..243 CDD:280422 54/140 (39%)
psme2NP_571449.1 PA28_alpha 13..65 CDD:280421 14/51 (27%)
PA28_beta 101..242 CDD:280422 55/144 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251022at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10660
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.