DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG and Psme1

DIOPT Version :9

Sequence 1:NP_001259502.1 Gene:REG / 32274 FlyBaseID:FBgn0029133 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_058960.2 Gene:Psme1 / 29630 RGDID:3429 Length:249 Species:Rattus norvegicus


Alignment Length:238 Identity:93/238 - (39%)
Similarity:138/238 - (57%) Gaps:1/238 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFEEVHQDLNIPVLPPLLVKNELED 72
            ||..:::.|..|.|.|:...||:.|..|:..|..|..||.|...:...|:|||..|:..| |.|:
  Rat    13 KVDVFREDLCSKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEK-EKEE 76

  Fly    73 RDSLPTKRQRVDVIVSGQPVMGLPAGTVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMWISFMIPK 137
            |.....|.::.:.....:...|.|.|.|.||:.:..:::.:||.|:.::|..||:..|:...||:
  Rat    77 RKKQQEKEEKDEKKKGDEDDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPR 141

  Fly   138 IEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAVVELDE 202
            |||||||||::||.....:.::.::...|..|||:||..|...|:|.||.||:.|||:.|.||||
  Rat   142 IEDGNNFGVAVQEKVFELMTSLHTKLEGFQTQISKYFSERGDAVAKAAKQPHVGDYRQLVHELDE 206

  Fly   203 KEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSNTESLY 245
            .||..:.|:|.|:||.|:.|:||::||.|||||||......:|
  Rat   207 AEYQEIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REGNP_001259502.1 PA28_alpha 5..60 CDD:280421 17/51 (33%)
PA28_beta 102..243 CDD:280422 63/140 (45%)
Psme1NP_058960.2 PA28_alpha 8..68 CDD:396706 19/54 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..102 12/42 (29%)
PA28_beta 104..246 CDD:396707 64/141 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352086
Domainoid 1 1.000 45 1.000 Domainoid score I11861
eggNOG 1 0.900 - - E1_KOG4470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251022at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10660
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.