DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG and Psme2

DIOPT Version :9

Sequence 1:NP_001259502.1 Gene:REG / 32274 FlyBaseID:FBgn0029133 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_058953.1 Gene:Psme2 / 29614 RGDID:3430 Length:238 Species:Rattus norvegicus


Alignment Length:238 Identity:80/238 - (33%)
Similarity:127/238 - (53%) Gaps:15/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFEEVHQDLNIPVLPPLLVKNELED 72
            :|..::.:|..:||..:....|..|:.|::||.....|..:...:...|:||:..|....:|:| 
  Rat    16 QVDAFRQNLFQEAEDFLCTFLPRKIISLSQLLQEDSLNVADLSSLRAPLDIPIPDPPPKDDEME- 79

  Fly    73 RDSLPTKRQRVDVIVSGQPVMGLPAGTVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMWISFMIPK 137
                 |::::.:|     |    ..|.:|.|:.|..::.:|||.:..|.|...|:..||..:|||
  Rat    80 -----TEQEKKEV-----P----KCGFLPGNEKLLALLALVKPEVWTLKEKCILVITWIQHLIPK 130

  Fly   138 IEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAVVELDE 202
            |||||:|||:|||..|..:..|:::..||...||:||..|...|:|.:|..|:.|||..|.|.||
  Rat   131 IEDGNDFGVAIQEKVLERVNAVKTKVEAFQTAISKYFSERGDAVAKASKDTHVMDYRALVHERDE 195

  Fly   203 KEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSNTESLY 245
            ..|.:|..:|.::|..|:.||.|:..||||:..|:.....|:|
  Rat   196 AAYGALRAMVLDLRAFYAELHHIISSNLEKIVNPKGEEKPSMY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REGNP_001259502.1 PA28_alpha 5..60 CDD:280421 12/51 (24%)
PA28_beta 102..243 CDD:280422 57/140 (41%)
Psme2NP_058953.1 PA28_alpha 13..65 CDD:280421 10/48 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..86 6/26 (23%)
PA28_beta 95..236 CDD:280422 57/140 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352084
Domainoid 1 1.000 45 1.000 Domainoid score I11861
eggNOG 1 0.900 - - E1_KOG4470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251022at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10660
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.