DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG and Psme2

DIOPT Version :9

Sequence 1:NP_001259502.1 Gene:REG / 32274 FlyBaseID:FBgn0029133 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_035320.1 Gene:Psme2 / 19188 MGIID:1096365 Length:239 Species:Mus musculus


Alignment Length:238 Identity:78/238 - (32%)
Similarity:126/238 - (52%) Gaps:14/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFEEVHQDLNIPVLPPLLVKNELED 72
            :|..::.:|..:|:..:....|..|:.|::||.....|..:...:...|:||:..|....:|:| 
Mouse    16 QVDVFRQNLFQEADDFLCTFLPRKIISLSQLLQEDSLNVADLSSLRAPLDIPIPDPPPKDDEME- 79

  Fly    73 RDSLPTKRQRVDVIVSGQPVMGLPAGTVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMWISFMIPK 137
                ..|:::.:|     |    ..|.:|.|:.|..::.:|||.:..|.|...|:..||..:|||
Mouse    80 ----TDKQEKKEV-----P----KCGYLPGNEKLLALLALVKPEVWTLKEKCILVITWIQHLIPK 131

  Fly   138 IEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAVVELDE 202
            |||||:|||:|||..|..:..|:::..||...||:||..|...|:|.:|..|:.|||..|.|.||
Mouse   132 IEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKDTHVMDYRALVHERDE 196

  Fly   203 KEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSNTESLY 245
            ..|.:|..:|.::|..|:.|:.|:..||||:..|:.....|:|
Mouse   197 AAYGALRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REGNP_001259502.1 PA28_alpha 5..60 CDD:280421 11/51 (22%)
PA28_beta 102..243 CDD:280422 56/140 (40%)
Psme2NP_035320.1 PA28_alpha 12..66 CDD:396706 10/49 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..87 6/26 (23%)
PA28_beta 94..235 CDD:396707 57/140 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848486
Domainoid 1 1.000 45 1.000 Domainoid score I12116
eggNOG 1 0.900 - - E1_KOG4470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251022at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10660
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.