DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment REG and psme3

DIOPT Version :9

Sequence 1:NP_001259502.1 Gene:REG / 32274 FlyBaseID:FBgn0029133 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001096200.1 Gene:psme3 / 100124751 XenbaseID:XB-GENE-981879 Length:254 Species:Xenopus tropicalis


Alignment Length:242 Identity:119/242 - (49%)
Similarity:178/242 - (73%) Gaps:5/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KVQEYKDSLILKAELLITKGFPENIVRLNELLATPIFNERNFEEVHQDLNIPVLPPLLVKNELED 72
            ||..:::.:..:||.|:...||:.::.|:..|...|.|.::..::|.::|:||..|:|:.|..:.
 Frog    14 KVDCFRERITSEAEDLVASFFPKKLLELDGFLKEQILNVQDLTQIHSEMNLPVPDPILLTNSHDG 78

  Fly    73 RDSLPTKRQR----VDVIVSGQPVMGLPAGTVPCNKPLCEMIKVVKPIIRKLVEDSNLLKMWISF 133
            .|: ||.::|    ||....|..|..:|.|.:..|..|.|:|:.|||.||.|:|..|.:|||:..
 Frog    79 LDA-PTLKKRKLEEVDENFPGTKVFVMPNGMLKSNAQLVEIIEKVKPEIRLLIEKCNTVKMWVQL 142

  Fly   134 MIPKIEDGNNFGVSIQEDTLAEIQTVESEAAAFFDQISRYFLSRAKVVSKVAKYPHIDDYRRAVV 198
            :||:|||||||||||||:|:||::|||||||::.||||||:::|||:|||:|||||::||||.|.
 Frog   143 LIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVT 207

  Fly   199 ELDEKEYLSLWLVVCEVRNRYSSLHDIVIKNLEKLKKPRSSNTESLY 245
            |:|||||:||.|::.|:||:|.:|||:::||:||:|:|||||.|:||
 Frog   208 EIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
REGNP_001259502.1 PA28_alpha 5..60 CDD:280421 13/51 (25%)
PA28_beta 102..243 CDD:280422 88/140 (63%)
psme3NP_001096200.1 PA28_alpha 9..69 CDD:366999 15/54 (28%)
PA28_beta 108..252 CDD:367000 88/143 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3843
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2111
Inparanoid 1 1.050 211 1.000 Inparanoid score I3570
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251022at2759
OrthoFinder 1 1.000 - - FOG0007262
OrthoInspector 1 1.000 - - oto102604
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4154
SonicParanoid 1 1.000 - - X5366
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.