DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq5 and MENG

DIOPT Version :9

Sequence 1:NP_001285193.1 Gene:Coq5 / 32272 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_173750.3 Gene:MENG / 838945 AraportID:AT1G23360 Length:261 Species:Arabidopsis thaliana


Alignment Length:247 Identity:73/247 - (29%)
Similarity:117/247 - (47%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QTVRESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRVWKDVFVERLGPTHGMRLLDMAGGTGDIT 115
            :||.:...|:::  :|.::|..||.:||.:|||.||:||::.|...|...|..:||:..|:||:.
plant    26 RTVVKCSNERRI--LFNRIAPVYDNLNDLLSLGQHRIWKNMAVSWSGAKKGDYVLDLCCGSGDLA 88

  Fly   116 FRYLRYLNNQPNPQQRPSHVTVSDINQHMLNVGEERAKRLGLTTDQLSNCTVAWQCADAEKLPFP 180
            |.....:.:       ...|...|.:...|.|.   |.|..|.......| :.|...||..|||.
plant    89 FLLSEKVGS-------TGKVMGLDFSSEQLAVA---ATRQSLKARSCYKC-IEWIEGDAIDLPFD 142

  Fly   181 DASFTAYTIAFGIRNCTHVDKVLSEAYRVLQPGGRFMCLEFS----HLTNETMQWLYDQYSFQVI 241
            |..|.|.|:.:|:||.....:.:.|.||||:||.|...|:|:    .:|.....|:.|    .|:
plant   143 DCEFDAVTMGYGLRNVVDRLRAMKEMYRVLKPGSRVSILDFNKSNQSVTTFMQGWMID----NVV 203

  Fly   242 PPMGQL--LAGQWQAYQYLVESIRRFPKQEQFKQMIEQAGFDQVSYENLTFG 291
            .|:..:  ||   :.|:||..||..:...|:.:.:..:|||....:..::.|
plant   204 VPVATVYDLA---KEYEYLKYSINGYLTGEELETLALEAGFSSACHYEISGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 73/247 (30%)
MENGNP_173750.3 PLN02233 1..261 CDD:177877 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1125002at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101003
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.