DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq5 and AT2G41040

DIOPT Version :9

Sequence 1:NP_001285193.1 Gene:Coq5 / 32272 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_181637.2 Gene:AT2G41040 / 818703 AraportID:AT2G41040 Length:352 Species:Arabidopsis thaliana


Alignment Length:218 Identity:48/218 - (22%)
Similarity:82/218 - (37%) Gaps:50/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RVWKDVFVERLG----------------PTHGMRLLDMAGGTGDITFRYLRYLNNQPNPQQRPSH 134
            |.|:..| :|.|                ...|..|:|::.|:|..:.::.:        ..:.|.
plant   155 RGWRQAF-KRSGFPGPDEEFRMAEEYFKEAEGGLLVDVSCGSGLFSRKFAQ--------SGKYSG 210

  Fly   135 VTVSDINQHMLNVGEERAKRLGLTTDQLSNCTVAWQCADAEKLPFPDASFTAYTIAFGIRNCTHV 199
            |...|.:::||...:|..|. ..|.|..:|..|.  .||..:||||..|..|......:......
plant   211 VIALDYSENMLRQCKEFIKN-DNTFDNSTNIAVV--RADVSRLPFPSGSVDAVHAGAALHCWPSP 272

  Fly   200 DKVLSEAYRVLQPGGRFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRR 264
            ...::|..|||:.||.|:...|...:..| .|:...:..:::           |:|.||:     
plant   273 TNAIAEICRVLRSGGVFVGTTFLRYSPST-PWIIRPFQSRIL-----------QSYNYLM----- 320

  Fly   265 FPKQEQFKQMIEQAGFDQVSYEN 287
               |::.|.:....|.  ..||:
plant   321 ---QDEIKDVCTSCGL--TDYED 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 48/218 (22%)
AT2G41040NP_181637.2 Methyltransf_11 189..290 CDD:400514 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.