DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq5 and SPBC1347.09

DIOPT Version :9

Sequence 1:NP_001285193.1 Gene:Coq5 / 32272 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:NP_596701.1 Gene:SPBC1347.09 / 2540005 PomBaseID:SPBC1347.09 Length:284 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:28/135 - (20%)
Similarity:54/135 - (40%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IHRVWKDVFVERLGPTHGMRLLDMAGGTGDITFRYLRYLNNQPNPQQRPSHVTVSDINQHMLNVG 148
            ::..||         ..||.:||.|.|||.|:.....|.          ..:...|::|.|::|.
pombe    70 VNNFWK---------KSGMSILDFACGTGLISQHLFPYC----------KQIVGIDVSQDMVDVY 115

  Fly   149 EERAKRLGLTTDQLSNCTVAWQCADAE---KLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYRVL 210
            .|:.:::.:..::.  |.......|.:   ..|| ...|.|...:....:...:.:|.::..::|
pombe   116 NEKFRKMNIPKERA--CAYVLSLDDLDGNGDEPF-STEFDAVVCSMAYHHIKDLQEVTNKLSKLL 177

  Fly   211 QPGGR 215
            :|.||
pombe   178 KPNGR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 28/135 (21%)
SPBC1347.09NP_596701.1 Methyltransf_18 77..187 CDD:289607 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.