DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq5 and coq5

DIOPT Version :9

Sequence 1:NP_001285193.1 Gene:Coq5 / 32272 FlyBaseID:FBgn0030460 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_002932125.1 Gene:coq5 / 100495452 XenbaseID:XB-GENE-981147 Length:311 Species:Xenopus tropicalis


Alignment Length:285 Identity:151/285 - (52%)
Similarity:194/285 - (68%) Gaps:33/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KTTHFGFQTVRESEKEQKVHEVFEQVANSYDVMNDAMSLGIHRVWKDVFVERLGPTHGMRLLDMA 108
            |.||||||||.|.||.:||:.|||.||::||:||||||||:||.|||..::.:.||.||:|||:|
 Frog    33 KETHFGFQTVSEEEKGEKVYRVFENVAHNYDIMNDAMSLGVHRFWKDWLLQLMKPTPGMQLLDVA 97

  Fly   109 GGTGDITFRYLRYLNNQ------------------------PNPQQRP---SHVTVSDINQHMLN 146
            ||||||.||::.|:..|                        .|.:|..   |...:.|||:.||.
 Frog    98 GGTGDIAFRFINYIRAQREKWIRQELKLQQDLSWPDISKTYQNKEQSSLMGSRAVICDINKEMLR 162

  Fly   147 VGEERAKRLGLTTDQLSNCTVAWQCADAEKLPFPDASFTAYTIAFGIRNCTHVDKVLSEAYRVLQ 211
            ||.:::.|||.:..      ::|...|||:|||.|..|..|||||||||.||:::.|.||||||:
 Frog   163 VGLQKSLRLGYSEG------LSWVAGDAEELPFDDDKFDVYTIAFGIRNVTHIEQALQEAYRVLK 221

  Fly   212 PGGRFMCLEFSHLTNETMQWLYDQYSFQVIPPMGQLLAGQWQAYQYLVESIRRFPKQEQFKQMIE 276
            |||||:|||||.:.|..:..|||.|||||||.:|:::||.|::||||||||||||.||:||.:||
 Frog   222 PGGRFLCLEFSQVNNPMLSKLYDIYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKALIE 286

  Fly   277 QAGFDQVSYENLTFGVVSIHSGFKL 301
            ..||.:|:|.|||.|||::||||||
 Frog   287 DVGFCKVNYHNLTNGVVAVHSGFKL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq5NP_001285193.1 ubiE 50..301 CDD:234689 144/277 (52%)
coq5XP_002932125.1 ubiE 39..311 CDD:234689 144/277 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 280 1.000 Domainoid score I1658
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6559
Inparanoid 1 1.050 302 1.000 Inparanoid score I2630
OMA 1 1.010 - - QHG62601
OrthoDB 1 1.010 - - D1125002at2759
OrthoFinder 1 1.000 - - FOG0004442
OrthoInspector 1 1.000 - - oto104053
Panther 1 1.100 - - LDO PTHR43591
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R235
SonicParanoid 1 1.000 - - X3146
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.