DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12096 and AT3G15180

DIOPT Version :9

Sequence 1:NP_001285190.1 Gene:CG12096 / 32269 FlyBaseID:FBgn0030457 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001189898.1 Gene:AT3G15180 / 820749 AraportID:AT3G15180 Length:551 Species:Arabidopsis thaliana


Alignment Length:384 Identity:72/384 - (18%)
Similarity:132/384 - (34%) Gaps:109/384 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ADSHVPKDQAVDVTLELLCHCLDQLAMDTADEQLSSLLRRGLTHSNPALRAQVLASLFKKLLRQL 124
            |||.|.|..|....|.||..|      ||.|                                  
plant    85 ADSAVVKSLACKTVLCLLEDC------DTND---------------------------------- 109

  Fly   125 TVGQVLTLPNNELIFLILDELKQPDTQSTSLAI----------NILSIVLPQRISNADVQAKLVQ 179
             |..|..:.||.:..|:||.:...|.:..:.|.          :.:|::.|...::......|. 
plant   110 -VSSVQLVVNNGIYPLLLDYIINSDDEVANAASETIKSLARFPDAMSVIFPSETNDPTHLRNLA- 172

  Fly   180 LLKQNEIVRCRAYELAVVLAKKSATLLSDV--TFILDAALSEL-DNDDVLLQASVMELLVPLAEQ 241
             .:.:.:.|.|...|.|.|...|..:.|:|  :.:||...:|: ...|.|:..:|:||...|.|.
plant   173 -ARCSSLARVRVLSLIVKLFSISRLVASEVKKSGLLDLLEAEMKGTKDTLVILNVLELYYELMEV 236

  Fly   242 NHGLSYMERRRVLDIISYRVQRVEEHPLDALLVPSIM-KFFGKISVYQPLKIIGGYPHMLACL-- 303
            .|...::.:..::.::...:......|.:.|....|. :...|.::|   |::.....::.||  
plant   237 EHSSEFVPQTSLIQLLCSIISGTSTGPYEKLRAMMISGRLLSKENIY---KVVEEARPVVPCLKA 298

  Fly   304 -----------------------------------FMQLQSEDESILPTAMDTLANLATTPQG-K 332
                                               ...::..|......|:|.|..:.:|.:| .
plant   299 SVCCAHKTSDEVEKLTTNCFVSECVKALISAIDGSLESVEMNDTDAQEAAIDALGQMGSTTKGAD 363

  Fly   333 ILLNMHFSGA---MEKSFKKYGSHTKKLSAHIKKRLLNSLDVIYDFKTPPATEIINIGK 388
            ::|:.....|   :..:|.: .:|.|:|:|      |::|..|.....|.:..|:: ||
plant   364 LVLSTSPPAARHVVASAFDR-NAHGKQLAA------LHALANIAGETRPKSNRIVD-GK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12096NP_001285190.1 Proteasom_PSMB 4..502 CDD:287479 72/384 (19%)
AT3G15180NP_001189898.1 Proteasom_PSMB 26..547 CDD:287479 72/384 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4413
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D602046at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104314
Panther 1 1.100 - - LDO PTHR13554
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.