DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap60 and TRI1

DIOPT Version :9

Sequence 1:NP_511143.2 Gene:Bap60 / 32268 FlyBaseID:FBgn0025463 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_013960.1 Gene:TRI1 / 855273 SGDID:S000004846 Length:226 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:62/283 - (21%)
Similarity:107/283 - (37%) Gaps:109/283 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KKKLAEKILPQKVRD-------LVPESQAYMDLLTFERKLDATIMRKRLDIQEALKRPMKQKRKL 184
            ::||..:::.::..|       |:|::    ||::.:::|.       |.:|:..:||::..|| 
Yeast    43 QRKLINELILERFGDIQENPRVLIPKN----DLISRDQELS-------LRLQKEEERPLRSTRK- 95

  Fly   185 RIFISNTFYPSKEPTNDGEEGAVASWELRVEGRLLEDGKGDPNTKIKRKFSSFFKSLVIELDKEL 249
                                                 .||...:|.|||            .|:.
Yeast    96 -------------------------------------RKGKSESKSKRK------------KKKN 111

  Fly   250 YGPDNHLVEWHRTHTTQETDGFQVKRPGDRNVRCTILLLLDYQPLQFKLDPRLARLLGVHTQTRP 314
            ..||::.:                      :||..:|    ..|||        :.||.....|.
Yeast   112 DSPDSNSI----------------------SVRKVLL----SAPLQ--------KFLGSEELPRT 142

  Fly   315 VIISALWQYIKTHKLQDAHEREYINCDKYLEQIFSCQRMKFAEIPQRLNPLLHPPDPIVINHFIE 379
            .::..:|||||.|.||:..:|..|.||:.:|.||. ::|....:.:.|...|..||.||     :
Yeast   143 QVVKMIWQYIKEHDLQNPKDRREILCDEKMEPIFG-KKMTMFSMNKLLTKHLFNPDEIV-----K 201

  Fly   380 SGAENKQTACYDIDVEVDDTLKN 402
            ...|.|||...:|.:| :::|.|
Yeast   202 HEEEQKQTPEKEIKLE-NESLPN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap60NP_511143.2 SWIB_BAF60A 295..371 CDD:349493 23/75 (31%)
TRI1NP_013960.1 Rsc6 1..226 CDD:227818 62/283 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344408
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1727
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.