DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap60 and AT3G48600

DIOPT Version :10

Sequence 1:NP_511143.2 Gene:Bap60 / 32268 FlyBaseID:FBgn0025463 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_001190034.1 Gene:AT3G48600 / 824020 AraportID:AT3G48600 Length:228 Species:Arabidopsis thaliana


Alignment Length:56 Identity:17/56 - (30%)
Similarity:24/56 - (42%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 FKLDPRLARLLGVHTQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFSCQ 351
            |.:...|||.:|....:....:..:.||...|.|.:....|.|.||..|:.||..|
plant    39 FPVSESLARFVGQSEVSFSTAMEKVEQYTDDHNLWNPENIEEILCDDNLKTIFDGQ 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap60NP_511143.2 SWIB_BAF60A 295..371 CDD:349493 17/56 (30%)
AT3G48600NP_001190034.1 SWIB 37..111 CDD:460488 17/56 (30%)
SWIB-MDM2_like 138..221 CDD:349489
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.