DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap60 and AT2G35605

DIOPT Version :10

Sequence 1:NP_511143.2 Gene:Bap60 / 32268 FlyBaseID:FBgn0025463 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_565810.1 Gene:AT2G35605 / 818127 AraportID:AT2G35605 Length:109 Species:Arabidopsis thaliana


Alignment Length:80 Identity:24/80 - (30%)
Similarity:40/80 - (50%) Gaps:12/80 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 LARLLGVHTQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFSCQ-RMKFAEIPQRLNPL 365
            ||..:|.:..:|...:..:|:|||.:.||:...:..|.||:.|:.|||.: .:.|.||.:.|:  
plant    40 LANFIGENEVSRTTAVKKIWEYIKLNNLQNPVNKREILCDEQLKTIFSGKDTVGFLEISKLLS-- 102

  Fly   366 LHPPDPIVINHFIES 380
                     .||.:|
plant   103 ---------QHFPKS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap60NP_511143.2 SWIB_BAF60A 295..371 CDD:349493 21/69 (30%)
AT2G35605NP_565810.1 SWIB 32..105 CDD:460488 21/75 (28%)

Return to query results.
Submit another query.