DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bap60 and T24G10.2

DIOPT Version :9

Sequence 1:NP_511143.2 Gene:Bap60 / 32268 FlyBaseID:FBgn0025463 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_498159.2 Gene:T24G10.2 / 175747 WormBaseID:WBGene00020779 Length:347 Species:Caenorhabditis elegans


Alignment Length:279 Identity:63/279 - (22%)
Similarity:86/279 - (30%) Gaps:115/279 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KRSNE----SRSLGGGGSKSDFATAKKKKKLAEKI----LPQKVRDLVPE--------SQAYMDL 152
            ||::|    |...||..|.||....::||:..||:    ||.|.:..|.|        ..|.||.
 Worm    67 KRNDENGSDSSDDGGTDSDSDHEEGEEKKEKTEKVKKEELPVKAKKEVKEDSDSDSGVEDAVMDG 131

  Fly   153 LTFERKLDATI---------MRKRLDIQEALKRPMKQKRKLRIFISNTFYPSKEPTNDGEEGAVA 208
            ....:|....|         ..:|....:|||:           |.||           .||   
 Worm   132 KKRGKKTTTRIPPDMASSIKSTRRAAASDALKQ-----------IRNT-----------SEG--- 171

  Fly   209 SWELRVEGRLLEDGK---GDPNTKIKRKFSSFFKSLVIELDKELYGPDNHLVEWHRTHTTQETDG 270
                   ||...:.|   .|||..:...|....|...|..:.:....|    :|.:         
 Worm   172 -------GRFANNKKKKVKDPNADMSGVFGPMTKLCYISTELQQVTKD----QWMK--------- 216

  Fly   271 FQVKRPGDRNVRCTILLLLDYQPLQFKLDPRLARLLGVHTQTRPVIISALWQYIKTHKLQDAHER 335
                       ||.                               ::.|||.|||.:.|:|....
 Worm   217 -----------RCD-------------------------------VVKALWDYIKENNLKDPKNG 239

  Fly   336 EYINCDKYLEQIFSCQRMK 354
            :||.||..||.||...|:|
 Worm   240 QYIICDSTLESIFKKNRLK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bap60NP_511143.2 SWIB_BAF60A 295..371 CDD:349493 18/60 (30%)
T24G10.2NP_498159.2 SWIB 196..272 CDD:128456 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5531
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1727
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.790

Return to query results.
Submit another query.