DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4318 and ZBTB5

DIOPT Version :9

Sequence 1:	NP_572860.2	Gene:	CG4318 / 32266	FlyBaseID:	FBgn0030455	Length:	236	Species:	Drosophila melanogaster
Sequence 2:	NP_055687.1	Gene:	ZBTB5 / 9925	HGNCID:	23836	Length:	677	Species:	Homo sapiens

Alignment Length:	106	Identity:	32/106 - (30%)
Similarity:	45/106 - (42%)	Gaps:	30/106 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly   126 NSNS-----NG------NGNVSQSSAQKDTK---------KKMLK----------KTHKCNICGK 160
            ||.|     ||      ||:.||....:.|:         ||.|.          :.:.|.||.|
Human   556 NSTSSQLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALSEHNVLVVEGARKYACKICCK 620

  Fly   161 YFMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHER 201
            .|:.....|.|:.||..||||.||:|.:.::|...|.:|.:
Human   621 TFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHSK 661

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4318	NP_572860.2	zf-AD	5..>64	CDD:285071
		C2H2 Zn finger	155..175	CDD:275368	7/19 (37%)
		zf-H2C2_2	167..192	CDD:290200	11/24 (46%)
		COG5048	<179..>236	CDD:227381	9/23 (39%)
		C2H2 Zn finger	183..203	CDD:275368	6/19 (32%)
		C2H2 Zn finger	214..234	CDD:275368
ZBTB5	NP_055687.1	BTB	14..119	CDD:279045
		BTB	25..119	CDD:197585
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	158..252
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	287..312
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	331..387
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	447..474
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	552..585		9/28 (32%)
		C2H2 Zn finger	615..635	CDD:275368	7/19 (37%)
		zf-H2C2_2	627..652	CDD:290200	11/24 (46%)
		C2H2 Zn finger	643..662	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165151359
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930