DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4318 and znf740b

DIOPT Version :9

Sequence 1:	NP_572860.2	Gene:	CG4318 / 32266	FlyBaseID:	FBgn0030455	Length:	236	Species:	Drosophila melanogaster
Sequence 2:	XP_005162447.1	Gene:	znf740b / 767693	ZFINID:	ZDB-GENE-060929-660	Length:	257	Species:	Danio rerio

Alignment Length:	85	Identity:	30/85 - (35%)
Similarity:	41/85 - (48%)	Gaps:	3/85 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   149 LKKTHKCNICGKYFMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYK 213
            ::|...|..|...|....|||.|:..|..|||:.|..|...:.|...|.||:||||..   :.|:
Zfish   134 VQKNFICEHCYSAFRSSYHLKRHILTHTGEKPFGCDMCDMRFIQRYHLERHKRVHSGE---KPYQ 195

  Fly   214 CSRCPKIFNRNSALKNHETM 233
            |.||.:.|:|...|..|..:
Zfish   196 CDRCQQNFSRTDRLLRHRRL 215

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4318	NP_572860.2	zf-AD	5..>64	CDD:285071
		C2H2 Zn finger	155..175	CDD:275368	7/19 (37%)
		zf-H2C2_2	167..192	CDD:290200	10/24 (42%)
		COG5048	<179..>236	CDD:227381	20/55 (36%)
		C2H2 Zn finger	183..203	CDD:275368	7/19 (37%)
		C2H2 Zn finger	214..234	CDD:275368	7/20 (35%)
znf740b	XP_005162447.1	C2H2 Zn finger	140..160	CDD:275368	7/19 (37%)
		C2H2 Zn finger	168..188	CDD:275368	7/19 (37%)
		C2H2 Zn finger	196..215	CDD:275368	7/18 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170585830
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930