| Sequence 1: | NP_572860.2 | Gene: | CG4318 / 32266 | FlyBaseID: | FBgn0030455 | Length: | 236 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001342539.1 | Gene: | Zbtb43 / 71834 | MGIID: | 1919084 | Length: | 504 | Species: | Mus musculus |
| Alignment Length: | 202 | Identity: | 44/202 - (21%) |
|---|---|---|---|
| Similarity: | 76/202 - (37%) | Gaps: | 38/202 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 58 LDAQTAYGMDSVQVIEQDEMVVSEMNYEEEGSNDS--------DVELIEPVDGSQEMETIDLTID 114
Fly 115 SPGDNVENMCPNSNSNGN---------------GNVSQSSAQKDTKKKM----LKKTHKCNICGK 160
Fly 161 YFMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNS 225
Fly 226 ALKNHET 232 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4318 | NP_572860.2 | zf-AD | 5..>64 | CDD:285071 | 1/5 (20%) |
| C2H2 Zn finger | 155..175 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 167..192 | CDD:290200 | 7/24 (29%) | ||
| COG5048 | <179..>236 | CDD:227381 | 14/54 (26%) | ||
| C2H2 Zn finger | 183..203 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 214..234 | CDD:275368 | 6/19 (32%) | ||
| Zbtb43 | NP_001342539.1 | BTB | 60..160 | CDD:306997 | |
| C2H2 Zn finger | 413..431 | CDD:275368 | 6/18 (33%) | ||
| C2H2 Zn finger | 439..459 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 451..474 | CDD:316026 | 7/25 (28%) | ||
| C2H2 Zn finger | 467..484 | CDD:275368 | 4/16 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167841500 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||