Sequence 1: | NP_572860.2 | Gene: | CG4318 / 32266 | FlyBaseID: | FBgn0030455 | Length: | 236 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006242517.1 | Gene: | Znf740 / 685834 | RGDID: | 1589052 | Length: | 205 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 54/202 - (26%) |
---|---|---|---|
Similarity: | 86/202 - (42%) | Gaps: | 41/202 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 CQSCALDAQTAYGMDSVQVIEQDEMVVSEM------NYEEEGSNDSDVELIEPVDGSQEME---T 108
Fly 109 IDLTIDSPGDNVENMCPNSNSNGNGNVSQSSAQKDTKKKM------------LKKTHKCNICGKY 161
Fly 162 FMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSA 226
Fly 227 LKNHETM 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4318 | NP_572860.2 | zf-AD | 5..>64 | CDD:285071 | 2/10 (20%) |
C2H2 Zn finger | 155..175 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 167..192 | CDD:290200 | 10/24 (42%) | ||
COG5048 | <179..>236 | CDD:227381 | 21/55 (38%) | ||
C2H2 Zn finger | 183..203 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 214..234 | CDD:275368 | 8/20 (40%) | ||
Znf740 | XP_006242517.1 | C2H2 Zn finger | 115..135 | CDD:275368 | 7/19 (37%) |
zf-H2C2_2 | 127..152 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 143..163 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 155..180 | CDD:290200 | 12/27 (44%) | ||
C2H2 Zn finger | 171..189 | CDD:275368 | 7/17 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166344845 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |