DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Zscan4f

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001103786.2 Gene:Zscan4f / 665902 MGIID:3708485 Length:506 Species:Mus musculus


Alignment Length:218 Identity:52/218 - (23%)
Similarity:86/218 - (39%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PKDPFPKTI------CQSCALDAQT-AYGMDSVQVIEQDEMVVSEMNYEEEGSNDSDVELIEPVD 101
            |||...:.|      |.:.:.:|.| .|..|::...:.|.:.:::..|..| ....|:....|.|
Mouse   263 PKDLSRENISEDKNNCYNTSRNAATQVYSGDNIPRNKSDSLFINKRIYHPE-PEVGDIPYGVPQD 326

  Fly   102 GSQEME-TIDLTIDSPGDNVENMCPNS------------------NSNGNGNVSQSSAQKDTKKK 147
            .::..: |.....:|.|:......|..                  ..|...|:...|.||...:.
Mouse   327 STRASQGTSTCLQESLGECFSEKDPREVPGLQSRQEQLISDPVLLGKNHEANLPCESHQKRFCRD 391

  Fly   148 MLKKTHKCNICGKYFMLPAHLKCHMWVHAREK-PYKCLQCSQSYAQIRGLRRHERVHSSRPELRS 211
              .|.:||..|.:.|.....|..|...|..:| ...|:.|.:.:.::...|.||.:|  .|| :.
Mouse   392 --AKLYKCEECSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIH--MPE-KP 451

  Fly   212 YKCSRCPKIFNRNSALKNHETMH 234
            :|||.|.|.|:..:.||:||.:|
Mouse   452 FKCSTCEKSFSHKTNLKSHEMIH 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 7/26 (27%)
C2H2 Zn finger 155..175 CDD:275368 5/19 (26%)
zf-H2C2_2 167..192 CDD:290200 6/25 (24%)
COG5048 <179..>236 CDD:227381 20/57 (35%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 214..234 CDD:275368 9/19 (47%)
Zscan4fNP_001103786.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
SCAN <51..117 CDD:295388
zf-C2H2 395..417 CDD:278523 6/21 (29%)
C2H2 Zn finger 397..417 CDD:275368 5/19 (26%)
C2H2 Zn finger 426..446 CDD:275368 5/19 (26%)
zf-H2C2_2 438..463 CDD:290200 12/27 (44%)
C2H2 Zn finger 454..474 CDD:275368 9/19 (47%)
zf-H2C2_2 466..491 CDD:290200 5/9 (56%)
C2H2 Zn finger 482..500 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.