DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Klf14

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001128565.1 Gene:Klf14 / 619665 MGIID:3577024 Length:325 Species:Mus musculus


Alignment Length:225 Identity:54/225 - (24%)
Similarity:85/225 - (37%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PGVSLATMISDW-CG-----------FPVLPKDPFPKTICQSCALDAQTAYGMDSVQVIEQDEMV 78
            |.:..|:.::|. ||           .|......|..|.|.|      ...|.:..|...:||:.
Mouse    81 PHLLAASALADLSCGAREDFREDSEEAPCASTSCFEPTWCSS------PTGGSEPTQAFFEDELS 139

  Fly    79 VSEMNYEEEGSNDSDVELIEPVDGSQEMETIDLTIDSPGDNVENMCPNSNSNGNGNVSQSSAQKD 143
            .:|       |:.||..:::..:.|:|          |.|:.|  .|..........|.....:.
Mouse   140 DAE-------SSCSDSAILDAPEASEE----------PDDSGE--VPEGPPGARPAPSTGPTYRR 185

  Fly   144 TKKKMLKKTHKCNI--CGKYFMLPAHLKCHMWVHAREKPYKC--LQCSQSYAQIRGLRRHERVHS 204
            .:.....|.|:|:.  |.|.:...:|||.|...|..|:|:.|  |.|.:.:.:...|.||.|.|:
Mouse   186 RQITPASKRHQCSFHGCNKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHT 250

  Fly   205 SRPELRSYKCSRCPKIFNRNSALKNHETMH 234
            ..   :.:.|..|||.|:|:..|..|...|
Mouse   251 GE---KRFSCPLCPKQFSRSDHLTKHARRH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 10/49 (20%)
C2H2 Zn finger 155..175 CDD:275368 7/21 (33%)
zf-H2C2_2 167..192 CDD:290200 10/26 (38%)
COG5048 <179..>236 CDD:227381 18/58 (31%)
C2H2 Zn finger 183..203 CDD:275368 7/21 (33%)
C2H2 Zn finger 214..234 CDD:275368 8/19 (42%)
Klf14NP_001128565.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..196 8/54 (15%)
COG5048 198..>283 CDD:227381 26/83 (31%)
C2H2 Zn finger 200..219 CDD:275368 6/18 (33%)
zf-H2C2_2 211..238 CDD:290200 10/26 (38%)
C2H2 Zn finger 227..249 CDD:275368 7/21 (33%)
zf-H2C2_2 241..266 CDD:290200 10/27 (37%)
C2H2 Zn finger 257..277 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 270..325 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5377
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.