DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and zbtb43

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001103494.1 Gene:zbtb43 / 557590 ZFINID:ZDB-GENE-060526-378 Length:410 Species:Danio rerio


Alignment Length:176 Identity:48/176 - (27%)
Similarity:78/176 - (44%) Gaps:35/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EMNYEEEGSN--DSDVELIEPVD--GSQEMETIDLTIDSPGDNVENMCPNS-------NSNGNGN 134
            |.:::|:.:.  |.|....||:|  || .||....|    ||.:.|  |.|       .:|.:|.
Zfish   239 EDSFDEKLTECLDRDCTYEEPLDFYGS-SMEGFSQT----GDELSN--PESKEKLQADGNNTDGP 296

  Fly   135 VSQSSAQKDTKK-----KMLKKTHKCNICGKYFMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIR 194
            ..:|.|..:...     .::.|.:.|. |||.|...:....||.:|...:|:.|..|.:|:....
Zfish   297 KDESPADSEQTSHSGFASVVYKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPFGCAVCGKSFKMKH 360

  Fly   195 GLRRHERVHSSRPELRSYKCSRCPK------IFNRNSA--LKNHET 232
            .|..|.::|:.   ::.|:||.|.|      .|||:::  .|.|:|
Zfish   361 HLVGHMKIHTG---IKPYECSLCSKRFMWRDSFNRHTSTCAKAHQT 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071
C2H2 Zn finger 155..175 CDD:275368 7/19 (37%)
zf-H2C2_2 167..192 CDD:290200 7/24 (29%)
COG5048 <179..>236 CDD:227381 18/62 (29%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 214..234 CDD:275368 10/27 (37%)
zbtb43NP_001103494.1 BTB 23..123 CDD:279045
BTB 34..124 CDD:197585
C2H2 Zn finger 323..341 CDD:275368 6/18 (33%)
C2H2 Zn finger 349..369 CDD:275368 5/19 (26%)
zf-H2C2_2 361..384 CDD:290200 8/25 (32%)
C2H2 Zn finger 377..396 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.