DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Zscan4d

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001093656.1 Gene:Zscan4d / 545913 MGIID:3645954 Length:506 Species:Mus musculus


Alignment Length:218 Identity:51/218 - (23%)
Similarity:87/218 - (39%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PKDPFPKTI------CQSCALDAQT-AYGMDSVQVIEQDEMVVSEMNYEEEGSNDSDVELIEPVD 101
            |||...:.|      |.:.:.:|.| .|..|::...:.|.:.:::..|..| ..:.|:....|.|
Mouse   263 PKDLSRENISEDKNNCYNTSRNAATQVYRSDNIPRKKTDSLSINKRIYHSE-PEEGDIPYGVPQD 326

  Fly   102 GSQEME-TIDLTIDSPGDNVENMCPNS------------------NSNGNGNVSQSSAQKDTKKK 147
            .::..: |.....:|.|:......|..                  ..:...|:...|.||..::.
Mouse   327 STRASQGTSTCLQESLGECFSEKDPRELPGLESRQEEPISDPVFLGKDHEANLPCESHQKRFRRD 391

  Fly   148 MLKKTHKCNICGKYFMLPAHLKCHMWVHAREK-PYKCLQCSQSYAQIRGLRRHERVHSSRPELRS 211
              .|..||..|.:.|.....|..|...|..:| ...|:.|.:.:.::...|.||.:|  .|| :.
Mouse   392 --AKLFKCEECSRMFKHARSLSSHQRTHLNKKSELLCVTCQKMFKRVSDRRTHEIIH--MPE-KP 451

  Fly   212 YKCSRCPKIFNRNSALKNHETMH 234
            :|||.|.|.|:..:.||:||.:|
Mouse   452 FKCSTCEKSFSHKTNLKSHEMIH 474

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 7/26 (27%)
C2H2 Zn finger 155..175 CDD:275368 5/19 (26%)
zf-H2C2_2 167..192 CDD:290200 6/25 (24%)
COG5048 <179..>236 CDD:227381 20/57 (35%)
C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
C2H2 Zn finger 214..234 CDD:275368 9/19 (47%)
Zscan4dNP_001093656.1 SCAN <51..117 CDD:295388