DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4318 and Klf13

DIOPT Version :9

Sequence 1:	NP_572860.2	Gene:	CG4318 / 32266	FlyBaseID:	FBgn0030455	Length:	236	Species:	Drosophila melanogaster
Sequence 2:	NP_067341.2	Gene:	Klf13 / 50794	MGIID:	1354948	Length:	289	Species:	Mus musculus

Alignment Length:	116	Identity:	33/116 - (28%)
Similarity:	52/116 - (44%)	Gaps:	13/116 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   125 PNSNSNGNGNVSQSSAQKDTKKKMLKKTHKCNI--CGKYFMLPAHLKCHMWVHAREKPYKC--LQ 185
            |.....|....|::..:...:|      |||:.  |.|.:...:|||.|:..|..|:|:.|  .:
Mouse   146 PGLRQRGRRGRSRADLESPQRK------HKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQE 204

  Fly   186 CSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSALKNHETMHHN 236
            |::.:|:...|.||.|.|:..   :.:.|..|.|.|.|:..|..|...|.|
Mouse   205 CNKKFARSDELARHYRTHTGE---KKFSCPICEKRFMRSDHLTKHARRHAN 252

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4318	NP_572860.2	zf-AD	5..>64	CDD:285071
		C2H2 Zn finger	155..175	CDD:275368	7/21 (33%)
		zf-H2C2_2	167..192	CDD:290200	9/26 (35%)
		COG5048	<179..>236	CDD:227381	17/58 (29%)
		C2H2 Zn finger	183..203	CDD:275368	7/21 (33%)
		C2H2 Zn finger	214..234	CDD:275368	7/19 (37%)
Klf13	NP_067341.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	23..54
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	70..168		4/27 (15%)
		COG5048	<163..253	CDD:227381	30/99 (30%)
		C2H2 Zn finger	170..192	CDD:275368	7/21 (33%)
		C2H2 Zn finger	200..222	CDD:275368	7/21 (33%)
		C2H2 Zn finger	230..250	CDD:275368	7/19 (37%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..289		2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	62	1.000	Inparanoid score	I5377
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.050