Sequence 1: | NP_572860.2 | Gene: | CG4318 / 32266 | FlyBaseID: | FBgn0030455 | Length: | 236 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_578644.3 | Gene: | Zscan4f / 503124 | RGDID: | 1563625 | Length: | 508 | Species: | Rattus norvegicus |
Alignment Length: | 199 | Identity: | 51/199 - (25%) |
---|---|---|---|
Similarity: | 86/199 - (43%) | Gaps: | 22/199 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 CQSCALDAQTAYGMDSVQVIEQDEMVVSEMNYEEEGSNDSDVE-------LIEPVDGSQEMETID 110
Fly 111 LTI--DSPGD--NVENMCPNSNSNGNGNVSQSSAQKDTKKKMLKKTH------KCNICGKYFMLP 165
Fly 166 AHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSALKNH 230
Fly 231 ETMH 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4318 | NP_572860.2 | zf-AD | 5..>64 | CDD:285071 | 2/10 (20%) |
C2H2 Zn finger | 155..175 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 167..192 | CDD:290200 | 7/24 (29%) | ||
COG5048 | <179..>236 | CDD:227381 | 21/56 (38%) | ||
C2H2 Zn finger | 183..203 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 214..234 | CDD:275368 | 9/19 (47%) | ||
Zscan4f | XP_578644.3 | SCAN | 53..124 | CDD:413396 | |
SFP1 | <349..472 | CDD:227516 | 36/126 (29%) | ||
zf-C2H2 | 398..420 | CDD:395048 | 6/21 (29%) | ||
C2H2 Zn finger | 400..420 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 428..448 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 454..476 | CDD:395048 | 10/21 (48%) | ||
C2H2 Zn finger | 456..476 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 484..502 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166344839 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |