DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Zscan4f

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_578644.3 Gene:Zscan4f / 503124 RGDID:1563625 Length:508 Species:Rattus norvegicus


Alignment Length:199 Identity:51/199 - (25%)
Similarity:86/199 - (43%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CQSCALDAQTAYGMDSVQVIEQDEMVVSEMNYEEEGSNDSDVE-------LIEPVDGSQEMETID 110
            |.:.:.:|......|::.:.:.|.:.:::..|..| ....||.       ...|...:.:.|::.
  Rat   283 CCTTSKNATQENSADNIPMRKMDSVFINQRMYHPE-PKMGDVSCGVPQGFTRSPGTSTSQQESLG 346

  Fly   111 LTI--DSPGD--NVENMCPNSNSNGNGNVSQSSAQKDTKKKMLKKTH------KCNICGKYFMLP 165
            ||.  |.|.|  .|.:. |...|:....:.|:.....|.|...|:.|      .|..|.:.|...
  Rat   347 LTFSEDDPRDIPGVPSR-PEKLSSEAVLLYQNQEANSTSKSHQKRLHVGPKQYNCEECPRTFKYA 410

  Fly   166 AHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSALKNH 230
            :||..|...|..:|.:.|..|.:::.:...||.||.:|:  || :.:|||.|.|.|:..:.||.|
  Rat   411 SHLSLHQRTHQNKKAFVCPTCQKTFKRASDLRCHEIIHN--PE-KPFKCSTCEKSFSHKTNLKAH 472

  Fly   231 ETMH 234
            |.:|
  Rat   473 ERIH 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 2/10 (20%)
C2H2 Zn finger 155..175 CDD:275368 6/19 (32%)
zf-H2C2_2 167..192 CDD:290200 7/24 (29%)
COG5048 <179..>236 CDD:227381 21/56 (38%)
C2H2 Zn finger 183..203 CDD:275368 6/19 (32%)
C2H2 Zn finger 214..234 CDD:275368 9/19 (47%)
Zscan4fXP_578644.3 SCAN 53..124 CDD:413396
SFP1 <349..472 CDD:227516 36/126 (29%)
zf-C2H2 398..420 CDD:395048 6/21 (29%)
C2H2 Zn finger 400..420 CDD:275368 6/19 (32%)
C2H2 Zn finger 428..448 CDD:275368 6/19 (32%)
zf-C2H2 454..476 CDD:395048 10/21 (48%)
C2H2 Zn finger 456..476 CDD:275368 9/19 (47%)
C2H2 Zn finger 484..502 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344839
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.