DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and klu

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001261690.1 Gene:klu / 39228 FlyBaseID:FBgn0013469 Length:818 Species:Drosophila melanogaster


Alignment Length:212 Identity:47/212 - (22%)
Similarity:85/212 - (40%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PKDPFPKTICQSCALDAQTAYGMDSVQVIEQDEMVV-----SEMNYEEEGSNDSDVELIE-PVDG 102
            |..|:...:..:.|..|..|..|..:      ||.:     .:|::.:..:....|.:|: .|..
  Fly   502 PNSPYANAMNAAHAAAAAAAAAMIKM------EMPLHPLHHQQMHHSQVPTTTVGVPVIKGDVAS 560

  Fly   103 SQEMETI----DLTID------SPGDNVENMCPNSNS--NGNGNVSQSSAQKDTKKKM---LKKT 152
            ....||:    :|.:.      .||.:|..:||....  :.:..:::..|.:...:..   :.|.
  Fly   561 PTTKETVAWRYNLDVSPVVEEMPPGSDVAYVCPTCGQMFSLHDRLAKHMASRHKSRNPANDIAKA 625

  Fly   153 HKCNICGKYFMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRC 217
            :.|::|.:.|.....|..||.:|...|||.|..|.|.:::...|..|:|.|:..   :.|||.:|
  Fly   626 YSCDVCRRSFARSDMLTRHMRLHTGVKPYTCKVCGQVFSRSDHLSTHQRTHTGE---KPYKCPQC 687

  Fly   218 PKIFNRNSALKNHETMH 234
            |....|...:..|...|
  Fly   688 PYAACRRDMITRHMRTH 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 4/19 (21%)
C2H2 Zn finger 155..175 CDD:275368 6/19 (32%)
zf-H2C2_2 167..192 CDD:290200 10/24 (42%)
COG5048 <179..>236 CDD:227381 18/56 (32%)
C2H2 Zn finger 183..203 CDD:275368 6/19 (32%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
kluNP_001261690.1 FYDLN_acid <182..248 CDD:302856
C2H2 Zn finger 592..613 CDD:275368 3/20 (15%)
COG5048 607..>687 CDD:227381 22/82 (27%)
zf-C2H2 626..648 CDD:278523 6/21 (29%)
C2H2 Zn finger 628..648 CDD:275368 6/19 (32%)
zf-H2C2_2 640..665 CDD:290200 10/24 (42%)
C2H2 Zn finger 656..676 CDD:275368 6/19 (32%)
zf-H2C2_2 668..690 CDD:290200 9/24 (38%)
C2H2 Zn finger 684..704 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.