DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and CG15436

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_608840.1 Gene:CG15436 / 33657 FlyBaseID:FBgn0031610 Length:346 Species:Drosophila melanogaster


Alignment Length:247 Identity:74/247 - (29%)
Similarity:115/247 - (46%) Gaps:31/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRMCRVCLREMENMLCIFETMPLPGVSLATMISDWCGFPVLPKDPFPKTICQSCALDAQTAYGMD 67
            :.:||||:.....::.||:......||:|.||:...||.|...|.|.:.||..|..|.::|||:.
  Fly     2 AEICRVCMDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRGDLFSEMICPQCYEDVKSAYGIR 66

  Fly    68 SVQVIEQDEMVVSEMNYEEEGSNDSDVELIEPVDGSQEMETIDLTIDSPGDNVENMCPNSNSNGN 132
              |..|:.......:  .:||..|:...|:|..|. :..|..|..|||        ...::.:|.
  Fly    67 --QTCEESHQFYCRV--RDEGIEDALCALLEEEDW-EISEDEDARIDS--------ASAADDDGK 118

  Fly   133 GNVSQSSAQ-KDTKKKMLKK--------TH------KCNICGKYFMLPAHLKCHMWVHAREKPYK 182
            .:..:.:.: ::..||..:|        ||      .|..|.:.|.|...||.||..|...|||:
  Fly   119 SDSKKVAFECRECHKKYQRKGTFLRHMRTHMDGQSFPCPYCKRNFRLRVTLKAHMKTHNAAKPYE 183

  Fly   183 CLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSALKNHETMH 234
            |..|::::||...|:.|||.|:..   |.:|||:|.|.|.::|.|:.|...|
  Fly   184 CSHCAKTFAQQSTLQSHERTHTGE---RPFKCSQCSKTFIKSSDLRRHIRTH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 20/58 (34%)
C2H2 Zn finger 155..175 CDD:275368 8/19 (42%)
zf-H2C2_2 167..192 CDD:290200 10/24 (42%)
COG5048 <179..>236 CDD:227381 23/56 (41%)
C2H2 Zn finger 183..203 CDD:275368 8/19 (42%)
C2H2 Zn finger 214..234 CDD:275368 8/19 (42%)
CG15436NP_608840.1 zf-AD 4..78 CDD:285071 25/75 (33%)
C2H2 Zn finger 128..148 CDD:275368 3/19 (16%)
C2H2 Zn finger 156..176 CDD:275368 8/19 (42%)
COG5048 <180..341 CDD:227381 23/56 (41%)
C2H2 Zn finger 184..204 CDD:275368 8/19 (42%)
zf-H2C2_2 197..219 CDD:290200 11/24 (46%)
C2H2 Zn finger 212..232 CDD:275368 8/19 (42%)
zf-H2C2_2 224..249 CDD:290200 3/9 (33%)
C2H2 Zn finger 240..260 CDD:275368
zf-H2C2_2 252..276 CDD:290200
C2H2 Zn finger 268..288 CDD:275368
C2H2 Zn finger 296..316 CDD:275368
C2H2 Zn finger 324..341 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.