DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Zbtb43

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001012094.1 Gene:Zbtb43 / 311872 RGDID:1310287 Length:503 Species:Rattus norvegicus


Alignment Length:201 Identity:43/201 - (21%)
Similarity:74/201 - (36%) Gaps:36/201 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LDAQTAYGMDSVQVIEQDEMVVSEMNYEEEGSNDS--------DVELIEPVDGSQEMETIDLTID 114
            :|...||  |..||.|....:.::.:.:..|:.:.        :||..|..:||...|.:|..  
  Rat   294 MDVHAAY--DEHQVSESVNTMQTDHSAQPSGAEEEFQIVEKKVEVEFDEHAEGSNYDEQVDFY-- 354

  Fly   115 SPGDNVENMCPNSNSNG--------------NGNVSQSSAQKDTKKKM----LKKTHKCNICGKY 161
              |.::|.........|              :.|:......|:....:    ..|.:.|. |||.
  Rat   355 --GSSMEEFSGEKLGGGLIGHKQETALAAGYSENIEMVMGIKEEASHLGFSATDKLYPCQ-CGKS 416

  Fly   162 FMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSA 226
            |...:....||.:|...:||.|..|.:.:.....|..|.::|:.   ::.|:|:.|.|.|....:
  Rat   417 FTHKSQRDRHMSMHLGLRPYGCSVCGKKFKMKHHLVGHMKIHTG---IKPYECNICAKRFMWRDS 478

  Fly   227 LKNHET 232
            ...|.|
  Rat   479 FHRHVT 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 1/5 (20%)
C2H2 Zn finger 155..175 CDD:275368 7/19 (37%)
zf-H2C2_2 167..192 CDD:290200 7/24 (29%)
COG5048 <179..>236 CDD:227381 14/54 (26%)
C2H2 Zn finger 183..203 CDD:275368 4/19 (21%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
Zbtb43NP_001012094.1 BTB_POZ_ZBTB43 44..164 CDD:349536
C2H2 Zn finger 412..430 CDD:275368 6/18 (33%)
C2H2 Zn finger 438..458 CDD:275368 4/19 (21%)
zf-H2C2_2 450..473 CDD:404364 7/25 (28%)
C2H2 Zn finger 466..483 CDD:275368 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.