Sequence 1: | NP_572860.2 | Gene: | CG4318 / 32266 | FlyBaseID: | FBgn0030455 | Length: | 236 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012094.1 | Gene: | Zbtb43 / 311872 | RGDID: | 1310287 | Length: | 503 | Species: | Rattus norvegicus |
Alignment Length: | 201 | Identity: | 43/201 - (21%) |
---|---|---|---|
Similarity: | 74/201 - (36%) | Gaps: | 36/201 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 LDAQTAYGMDSVQVIEQDEMVVSEMNYEEEGSNDS--------DVELIEPVDGSQEMETIDLTID 114
Fly 115 SPGDNVENMCPNSNSNG--------------NGNVSQSSAQKDTKKKM----LKKTHKCNICGKY 161
Fly 162 FMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRCPKIFNRNSA 226
Fly 227 LKNHET 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4318 | NP_572860.2 | zf-AD | 5..>64 | CDD:285071 | 1/5 (20%) |
C2H2 Zn finger | 155..175 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 167..192 | CDD:290200 | 7/24 (29%) | ||
COG5048 | <179..>236 | CDD:227381 | 14/54 (26%) | ||
C2H2 Zn finger | 183..203 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 214..234 | CDD:275368 | 6/19 (32%) | ||
Zbtb43 | NP_001012094.1 | BTB_POZ_ZBTB43 | 44..164 | CDD:349536 | |
C2H2 Zn finger | 412..430 | CDD:275368 | 6/18 (33%) | ||
C2H2 Zn finger | 438..458 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 450..473 | CDD:404364 | 7/25 (28%) | ||
C2H2 Zn finger | 466..483 | CDD:275368 | 4/16 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166344847 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |