DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and Zbtb5

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001100127.1 Gene:Zbtb5 / 298084 RGDID:1307367 Length:670 Species:Rattus norvegicus


Alignment Length:137 Identity:32/137 - (23%)
Similarity:54/137 - (39%) Gaps:33/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 VVSEMNYEEEGSNDSDVELIEPVDGSQEMETIDLTIDSPGDNVENMCPNSNSNGNGNVSQSSAQK 142
            ||:.:...:...|.:..:|:  ::|:...|                  |.:|:..|....:.|..
  Rat   538 VVTSVRSSQISENQASSQLM--MNGASSFE------------------NGHSSQPGPPQLTRASA 582

  Fly   143 DTKKKMLK-------------KTHKCNICGKYFMLPAHLKCHMWVHAREKPYKCLQCSQSYAQIR 194
            |...|..|             :.:.|.||.|.|:.....|.|:.||..||||.||:|.:.::|..
  Rat   583 DVLSKCKKALSEHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSS 647

  Fly   195 GLRRHER 201
            .|.:|.:
  Rat   648 HLYKHSK 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071
C2H2 Zn finger 155..175 CDD:275368 7/19 (37%)
zf-H2C2_2 167..192 CDD:290200 11/24 (46%)
COG5048 <179..>236 CDD:227381 9/23 (39%)
C2H2 Zn finger 183..203 CDD:275368 6/19 (32%)
C2H2 Zn finger 214..234 CDD:275368
Zbtb5NP_001100127.1 BTB_POZ_ZBTB5 3..128 CDD:349505
C2H2 Zn finger 608..628 CDD:275368 7/19 (37%)
zf-H2C2_2 622..645 CDD:404364 11/22 (50%)
C2H2 Zn finger 636..655 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.