DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and ZNF740

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_006719407.1 Gene:ZNF740 / 283337 HGNCID:27465 Length:207 Species:Homo sapiens


Alignment Length:205 Identity:52/205 - (25%)
Similarity:81/205 - (39%) Gaps:51/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ICQSCALDAQTAYGMDSVQVIEQDEMVVSEM------NYEEEGSNDSDVELIEPVDGSQEMETID 110
            :.|:..|..:...|:..|......:|::|::      |.|..||.|.                  
Human     1 MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDV------------------ 47

  Fly   111 LTIDSPGDNVENMCPNSNSNGNGNVSQSSAQKDTKKKM------------LKKTHKCNICGKYFM 163
            |...|.|...::....|..: :.::|::|..|.|.||:            :.|...|..|...|.
Human    48 LRCSSQGHRKDSDKSRSRKD-DDSLSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFR 111

  Fly   164 LPAHLKCHMWVHAREKPYKCLQCSQSYAQIRGLRRHERVHSSRPELRSYKCSRC--------PKI 220
            ...|||.|:.:|..|||::|..|...:.|...|.||:||||..   :.|:|.||        ||:
Human   112 SSYHLKRHILIHTGEKPFECDICDMRFIQKYHLERHKRVHSGE---KPYQCERCHQEQPKTGPKL 173

  Fly   221 FN---RNSAL 227
            .|   ||..:
Human   174 ANSCSRNKGI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071 2/11 (18%)
C2H2 Zn finger 155..175 CDD:275368 7/19 (37%)
zf-H2C2_2 167..192 CDD:290200 10/24 (42%)
COG5048 <179..>236 CDD:227381 21/60 (35%)
C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
C2H2 Zn finger 214..234 CDD:275368 8/25 (32%)
ZNF740XP_006719407.1 COG5048 96..>178 CDD:227381 29/84 (35%)
C2H2 Zn finger 103..123 CDD:275368 7/19 (37%)
zf-H2C2_2 115..140 CDD:290200 10/24 (42%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
zf-H2C2_2 143..>163 CDD:290200 10/22 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.