DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4318 and Zfp367

DIOPT Version :9

Sequence 1:	NP_572860.2	Gene:	CG4318 / 32266	FlyBaseID:	FBgn0030455	Length:	236	Species:	Drosophila melanogaster
Sequence 2:	NP_780703.1	Gene:	Zfp367 / 238673	MGIID:	2442266	Length:	340	Species:	Mus musculus

Alignment Length:	135	Identity:	33/135 - (24%)
Similarity:	57/135 - (42%)	Gaps:	27/135 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   118 DNVENMCPNSNSNGNGNVSQSSAQKDTKKKMLKKTH------KCNICGKYFMLPAHLKCHMWVHA 176
            |..|...|:|....:| :.:...:.||.:.::.:..      :||||.:.|.....|:.|...|.
Mouse   117 DEEEASSPDSGHLKDG-IRRGRPRADTVRDLINEGEHSSSRIRCNICNRVFPREKSLQAHKRTHT 180

  Fly   177 REKPYKC--LQCSQSYAQIRGLRRHERVHSSRPELRSYKCS-------------RCPKIFNRNSA 226
            .|:||.|  ..|.:::.|...|:.|:|:|:..   :.:.||             .|||  :..:.
Mouse   181 GERPYLCDYPDCGKAFVQSGQLKTHQRLHTGE---KPFVCSENGCLSRFTHANRHCPK--HPYAR 240

  Fly   227 LKNHE 231
            ||..|
Mouse   241 LKREE 245

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4318	NP_572860.2	zf-AD	5..>64	CDD:285071
		C2H2 Zn finger	155..175	CDD:275368	7/19 (37%)
		zf-H2C2_2	167..192	CDD:290200	8/26 (31%)
		COG5048	<179..>236	CDD:227381	17/68 (25%)
		C2H2 Zn finger	183..203	CDD:275368	6/21 (29%)
		C2H2 Zn finger	214..234	CDD:275368	8/31 (26%)
Zfp367	NP_780703.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	101..140		5/23 (22%)
		COG5048	157..>230	CDD:227381	20/75 (27%)
		zf-C2H2	158..179	CDD:278523	7/20 (35%)
		C2H2 Zn finger	159..179	CDD:275368	7/19 (37%)
		zf-H2C2_2	171..198	CDD:290200	8/26 (31%)
		C2H2 Zn finger	187..209	CDD:275368	6/21 (29%)
		zf-H2C2_2	202..228	CDD:290200	6/28 (21%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	280..317
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167841496
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930