DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4318 and ZNF367

DIOPT Version :9

Sequence 1:NP_572860.2 Gene:CG4318 / 32266 FlyBaseID:FBgn0030455 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_710162.1 Gene:ZNF367 / 195828 HGNCID:18320 Length:350 Species:Homo sapiens


Alignment Length:135 Identity:33/135 - (24%)
Similarity:57/135 - (42%) Gaps:27/135 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DNVENMCPNSNSNGNGNVSQSSAQKDTKKKMLKKTH------KCNICGKYFMLPAHLKCHMWVHA 176
            |..|...|:|....:| :.:...:.||.:.::.:..      :||||.:.|.....|:.|...|.
Human   127 DEEEASSPDSGHLKDG-IRRGRPRADTVRDLINEGEHSSSRIRCNICNRVFPREKSLQAHKRTHT 190

  Fly   177 REKPYKC--LQCSQSYAQIRGLRRHERVHSSRPELRSYKCS-------------RCPKIFNRNSA 226
            .|:||.|  ..|.:::.|...|:.|:|:|:..   :.:.||             .|||  :..:.
Human   191 GERPYLCDYPDCGKAFVQSGQLKTHQRLHTGE---KPFVCSENGCLSRFTHANRHCPK--HPYAR 250

  Fly   227 LKNHE 231
            ||..|
Human   251 LKREE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4318NP_572860.2 zf-AD 5..>64 CDD:285071
C2H2 Zn finger 155..175 CDD:275368 7/19 (37%)
zf-H2C2_2 167..192 CDD:290200 8/26 (31%)
COG5048 <179..>236 CDD:227381 17/68 (25%)
C2H2 Zn finger 183..203 CDD:275368 6/21 (29%)
C2H2 Zn finger 214..234 CDD:275368 8/31 (26%)
ZNF367NP_710162.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..151 5/24 (21%)
COG5048 167..>240 CDD:227381 20/75 (27%)
zf-C2H2 168..189 CDD:278523 7/20 (35%)
C2H2 Zn finger 169..189 CDD:275368 7/19 (37%)
zf-H2C2_2 181..208 CDD:290200 8/26 (31%)
C2H2 Zn finger 197..219 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151361
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.